Recombinant Full Length Nitrobacter Hamburgensis Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva(Ndva) Protein, His-Tagged
Cat.No. : | RFL35943NF |
Product Overview : | Recombinant Full Length Nitrobacter hamburgensis Beta-(1-->2)glucan export ATP-binding/permease protein NdvA(ndvA) Protein (Q1QH37) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nitrobacter hamburgensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | MSMLRLYTRVLELLGKEARLGWILAGANLLLAGAQFAEPVLFGRIVDVLSGSPAAGPFGM TSTSPWPLLAVWVVFGLFTILCGVIVALQADRLSHRQRQAVLTGYFEHIMQLPLTYHAGT HSGRLMKVMLQGTDALWRLWLGFFREHFAAMMSLVVLLPLSLTINWRLAILLFALCIVFT MLTTLVVRRTFDMQNEVEAHFSDLSARASDALGNVALVQSFVRVDAEVQGLRFVVDKLLA AQMPVLSWWAVVTVMTRASTTITILAIFAVGIVLNQRGMTSVGEIVMFVSFATMLIQRLE QVVSFINSVFMEAPRLKEFFNVLDAVPAVRDRPDAIDAGRLQGLVEFHDVSFSYDGKRPA VEDLSFVALPGQTIALVGPTGAGKSTAVALLHRAFDPQSGIIKIDGMDIRGLTLASLRRN IGVVFQEALLFDRSIAENLRVGKPDASEEEMRLAASRAQALGFIERADRKFDTHAGERGR MLSGGERQRLSIARALLKDPPILILDEATSALDAVTEAKVNAALDEVMKGRTTFVIAHRL STIRNATRILVFENGRVIENGTFDELLARGGHFARLAKAQFMTQDGSRIGQPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; Nham_3736; Beta-(1-->2glucan export ATP-binding/permease protein NdvA |
UniProt ID | Q1QH37 |
◆ Native Proteins | ||
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
ALB-4783D | Native Dog Albumin | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMBRA1-8887HCL | Recombinant Human AMBRA1 293 Cell Lysate | +Inquiry |
CCDC89-7743HCL | Recombinant Human CCDC89 293 Cell Lysate | +Inquiry |
SNX19-1661HCL | Recombinant Human SNX19 cell lysate | +Inquiry |
AQP8-34HCL | Recombinant Human AQP8 lysate | +Inquiry |
MYO19-4011HCL | Recombinant Human MYO19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket