Recombinant Full Length Nitrate Reductase-Like Protein Narx(Narx) Protein, His-Tagged
Cat.No. : | RFL2146HF |
Product Overview : | Recombinant Full Length Nitrate reductase-like protein narX(narX) Protein (P71994) (1-652aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-652) |
Form : | Lyophilized powder |
AA Sequence : | MTVTPRTGSRIEELLARSGRFFIPGEISADLRTVTRRGGRDGDVFYRDRWSHDKVVRSTH GVNCTGSCSWKIYVKDDIITWETQETDYPSVGPDRPEYEPRGCPRGAAFSWYTYSPTRVR HPYARGVLVEMYREAKARLGDPVAAWADIQADPRRRRRYQRARGKGGLVRVSWAEATEMI AAAHVHTISTYGPDRVAGFSPIPAMSMVSHAAGSRFVELIGGVMTSFYDWYADLPVASPQ VFGDQTDVPESGDWWDVVWQCASVLLTYPNSRQLGTAEELLAHIDGPAADLLGRTVSELR RADPLTAATRYVDTFDLRGRATLYLTYWTAGDTRNRGREMLAFAQTYRSTDVAPPRGETP DFLPVVLEFAATVDPEAGRRLLSGYRVPIAALCNALTEAALPYAHTVAAVCRTGDMMGEL FWTVVPYVTMTIVAVGSWWRYRYDKFGWTTRSSQLYESRLLRIASPMFHFGILVVIVGHG IGLVIPQSWTQAAGLSEGAYHVQAVVLGSIAGITTLAGVTLLIYRRRTRGPVFMATTVND KVMYLVLVAAIVAGLGATALGSGVVGEAYNYRETVSVWFRSVWVLQPRGDLMAEAPLYYQ IHVLIGLALFALWPFTRLVHAFSAPIGYLFRPYIIYRSREELVLTRPRRRGW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nitrate reductase-like protein narX(narX) |
UniProt ID | P71994 |
◆ Recombinant Proteins | ||
AES-398H | Recombinant Human AES Protein, GST-tagged | +Inquiry |
P4HA3-4591H | Recombinant Human P4HA3 protein, His-SUMO-tagged | +Inquiry |
SDHD-31390TH | Recombinant Human SDHD | +Inquiry |
DOPEY2-4772M | Recombinant Mouse DOPEY2 Protein | +Inquiry |
Sema4a-5758M | Recombinant Mouse Sema4a Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
Lectin-1717U | Native Ulex europaeus Lectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NARFL-3968HCL | Recombinant Human NARFL 293 Cell Lysate | +Inquiry |
Ramos-023HCL | Human Ramos Whole Cell Lysate | +Inquiry |
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
KIR2DL3-1840HCL | Recombinant Human KIR2DL3 cell lysate | +Inquiry |
B31-011BCL | Borrelia burgdorferi (B31 Strain) Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Nitrate reductase-like protein narX(narX) Products
Required fields are marked with *
My Review for All Nitrate reductase-like protein narX(narX) Products
Required fields are marked with *
0
Inquiry Basket