Recombinant Full Length Nitrate/Nitrite Sensor Protein Narx(Narx) Protein, His-Tagged
Cat.No. : | RFL34592SF |
Product Overview : | Recombinant Full Length Nitrate/nitrite sensor protein narX(narX) Protein (P0AFA4) (1-598aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-598) |
Form : | Lyophilized powder |
AA Sequence : | MLKRCLSPLTLVNQVALIVLLSTAIGLAGMAVSGWLVQGVQGSAHAINKAGSLRMQSYRL LAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNR ETVSADVSQFVAGLDQLVSGFDRTTEMRIETVVLVHRVMAVFMALLLVFTIIWLRARLLQ PWRQLLAMASAVSHRDFTQRANISGRNEMAMLGTALNNMSAELAESYAVLEQRVQEKTAG LEHKNQILSFLWQANRRLHSRAPLCERLSPVLNGLQNLTLLRDIELRVYDTDDEENHQEF TCQPDMTCDDKGCQLCPRGVLPVGDRGTTLKWRLADSHTQYGILLATLPQGRHLSHDQQQ LVDTLVEQLTATLALDRHQERQQQLIVMEERATIARELHDSIAQSLSCMKMQVSCLQMQG DALPESSRELLSQIRNELNASWAQLRELLTTFRLQLTEPGLRPALEASCEEYSAKFGFPV KLDYQLPPRLVPSHQAIHLLQIAREALSNALKHSQASEVVVTVAQNDNQVKLTVQDNGCG VPENAIRSNHYGMIIMRDRAQSLRGDCRVRRRESGGTEVVVTFIPEKTFTDVQGDTHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | narX |
Synonyms | narX; SF1225; S1309; Nitrate/nitrite sensor protein NarX |
UniProt ID | P0AFA4 |
◆ Recombinant Proteins | ||
PCDHB14-6544M | Recombinant Mouse PCDHB14 Protein, His (Fc)-Avi-tagged | +Inquiry |
EHMT2-2690M | Recombinant Mouse EHMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KAT6A-3156R | Recombinant Rat KAT6A Protein | +Inquiry |
MYLK4-8064HF | Active Recombinant Full Length Human MYLK4 Protein, DDK-tagged, Biotinylated | +Inquiry |
GUCA1A-1989H | Recombinant Human GUCA1A protein | +Inquiry |
◆ Native Proteins | ||
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
ALPL-25H | Active Native Human ALPL Protein | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
GARS-6020HCL | Recombinant Human GARS 293 Cell Lysate | +Inquiry |
ST3GAL5-1440HCL | Recombinant Human ST3GAL5 293 Cell Lysate | +Inquiry |
Pituitary-542E | Equine Pituitary Lysate, Total Protein | +Inquiry |
SF295-012WCY | Human Glioblastoma SF295 Whole Cell Lysate | +Inquiry |
ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All narX Products
Required fields are marked with *
My Review for All narX Products
Required fields are marked with *
0
Inquiry Basket