Recombinant Full Length Nicotiana Tabacum Omega-3 Fatty Acid Desaturase, Endoplasmic Reticulum(Fad3) Protein, His-Tagged
Cat.No. : | RFL31921NF |
Product Overview : | Recombinant Full Length Nicotiana tabacum Omega-3 fatty acid desaturase, endoplasmic reticulum(FAD3) Protein (P48626) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nicotiana tabacum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MGSLGISEIYDKNSFNEMEFEFDPSAPPPFRLAEIRNVIPKHCWVKDPLRSLSYVVRDVI FVATLIGIAIHLDSWLFYPLYWAIQGTMFWAIFVLGHDCGHGSFSDSQLLNNVVGHILHS AILVPYHGWRISHKTHHQNHGNVETDESWVPMPEKLYNKVGYSTKFLRYKIPFPLLAYPM YLMKRSPGKSGSHFNPYSDLFQPHERKYVVTSTLCWTVMAALLLYLCTAFGSLQMFKIYG APYLIFVMWLDFVTYLHHHGYEKKLPWYRGKEWSYLRGGLTTVDRDYGLFNNIHHDIGTH VIHHLFPQIPHYHLREATKAAKPVLGKYYREPKKSGPIPFHLVKDLTRSMKQDHYVSDSG EIVFYQTDPHIFRSAPKDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAD3 |
Synonyms | FAD3; Omega-3 fatty acid desaturase, endoplasmic reticulum |
UniProt ID | P48626 |
◆ Native Proteins | ||
HPX-84R | Native Rat Hemopexin | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
IBVF0704-224I | Native Influenza (B/Florida 07/04 ) IBVF0704 protein | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
KCNK16-354HCL | Recombinant Human KCNK16 lysate | +Inquiry |
KLHDC7B-4918HCL | Recombinant Human KLHDC7B 293 Cell Lysate | +Inquiry |
C17orf62-8234HCL | Recombinant Human C17orf62 293 Cell Lysate | +Inquiry |
KIAA0195-4981HCL | Recombinant Human KIAA0195 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAD3 Products
Required fields are marked with *
My Review for All FAD3 Products
Required fields are marked with *
0
Inquiry Basket