Recombinant Full Length Nicotiana Tabacum Cytochrome B-C1 Complex Subunit Rieske-1, Mitochondrial Protein, His-Tagged
Cat.No. : | RFL6233NF |
Product Overview : | Recombinant Full Length Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-1, mitochondrial Protein (P49729) (47-258aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nicotiana tabacum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (47-258) |
Form : | Lyophilized powder |
AA Sequence : | SSNSVSPAHDMGLVPDLPPTVAAIKNPTSKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLMRLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTED DISLANSVDLGSLRDPQQDAERVKNPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSH YDISGRIRKGPAPYNLEVPTYSFLEENKLLIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-1, mitochondrial |
Synonyms | Cytochrome b-c1 complex subunit Rieske-1, mitochondrial; Complex III subunit 5-1; Rieske iron-sulfur protein 1; RISP1; Ubiquinol-cytochrome c reductase iron-sulfur subunit 1; Fragment |
UniProt ID | P49729 |
◆ Recombinant Proteins | ||
marA-4384S | Recombinant Shigella sonnei (strain Ss046) marA protein, His&Myc-tagged | +Inquiry |
TUBGCP4-3484H | Recombinant Human TUBGCP4, GST-tagged | +Inquiry |
IRX1-5748HF | Recombinant Full Length Human IRX1 Protein, GST-tagged | +Inquiry |
RASSF4-3799R | Recombinant Rhesus monkey RASSF4 Protein, His-tagged | +Inquiry |
RFL7472BF | Recombinant Full Length Bartonella Tribocorum Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CAT-26409TH | Native Human CAT | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
SERPIND1-12H | Native Human Heparin Cofactor II | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLK5-487HCL | Recombinant Human PLK5 lysate | +Inquiry |
ASPHD1-8642HCL | Recombinant Human ASPHD1 293 Cell Lysate | +Inquiry |
FGGY-6230HCL | Recombinant Human FGGY 293 Cell Lysate | +Inquiry |
DPH5-507HCL | Recombinant Human DPH5 cell lysate | +Inquiry |
MPC1-8404HCL | Recombinant Human BRP44L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-1, mitochondrial Products
Required fields are marked with *
My Review for All Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-1, mitochondrial Products
Required fields are marked with *
0
Inquiry Basket