Recombinant Full Length Neurospora Crassa Palmitoyltransferase Erf2(Erf-2) Protein, His-Tagged
Cat.No. : | RFL20003NF |
Product Overview : | Recombinant Full Length Neurospora crassa Palmitoyltransferase ERF2(erf-2) Protein (Q7SFL7) (1-680aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neurospora Crassa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-680) |
Form : | Lyophilized powder |
AA Sequence : | MASEEGPSRSASPTNVDNTFPQYPPRAELTVAGPPSLISSRMTDIGTEDGQGSDTTPRGG GPSSANPNRRSGFYSDTQSRPETSGTGLSSRGPWAQSVPLRQQLTGKRGSIAGSIGSAGG RPISAASRSHVPSLTSHGFFRPMSSQKLQAQRGAGRPPTMNRPYVITGEAGARNSVISTG SGRIGAQIAEDAELRMPSRGTEMTEQETMERMTANTSPINGFFPTSSVTDSVRPLQSPVD ARNINVEMNKDYREESPTTPPRSPTRTSRSFRSSFLMPRMNESGITGSNREIEGGEKLQS AASSPNIPPQSYERQRARFKRRAKRQNRANLGKNYEYFEGNTVFCLGGRFQNTKQRPINI ATGSLIVLPCILFFIFSAPWIWHNISPAIPVTFAYLAYICVSSFLHASASDPGILPRNLH KFPPPEMEDSPTGPPTTDWVLVHSAEASTAAMEVPIKYCKTCQLWRPPRAHHCRLCDNCV ETQDHHCVWLNNCVGRRNYRYFFTFVSSATVLALYLIGACLAQILVYKNQHHISFGHAVN HFRVPFAMVFFGFLTFLYPAALTGYHIFLMARGETTREYLNSHKFPKSDRYRAFTQANWL KNWFVVLCRPRPPTYYGFKVKYNQGDQRLGSHRRWQQPAVSDSKEGMEMQNVSPQLPQTG FMGPTALRNSNNGSTAEVRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ptr-2 |
Synonyms | ptr-2; erf2; B15B3.180; NCU02015; Palmitoyltransferase erf2; DHHC cysteine-rich domain-containing protein erf2; Palmitoyltransferase 2; Ras protein acyltransferase |
UniProt ID | Q7SFL7 |
◆ Recombinant Proteins | ||
RPS6KA4-6718Z | Recombinant Zebrafish RPS6KA4 | +Inquiry |
IL10RA-4296H | Recombinant Human IL10RA Protein (His22-Asn235), C-Fc tagged | +Inquiry |
RFL3418MF | Recombinant Full Length Methanococcus Maripaludis Tetrahydromethanopterin S-Methyltransferase Subunit E(Mtre) Protein, His-Tagged | +Inquiry |
MAGI3-1990C | Recombinant Chicken MAGI3 | +Inquiry |
CCR5-3019HF | Recombinant Full Length Human CCR5 Protein | +Inquiry |
◆ Native Proteins | ||
ALPL-66C | Active Native Calf Alkaline Phosphatase | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
◆ Cell & Tissue Lysates | ||
CerebralCortex-424S | Sheep Cerebral Cortex Lysate, Total Protein | +Inquiry |
CNTFR-598RCL | Recombinant Rat CNTFR cell lysate | +Inquiry |
TRPC7-740HCL | Recombinant Human TRPC7 293 Cell Lysate | +Inquiry |
OSGEPL1-1261HCL | Recombinant Human OSGEPL1 cell lysate | +Inquiry |
METTL22-83HCL | Recombinant Human METTL22 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ptr-2 Products
Required fields are marked with *
My Review for All ptr-2 Products
Required fields are marked with *
0
Inquiry Basket