Recombinant Full Length Nephroselmis Olivacea Cytochrome B6(Petb) Protein, His-Tagged
Cat.No. : | RFL5709NF |
Product Overview : | Recombinant Full Length Nephroselmis olivacea Cytochrome b6(petB) Protein (Q9TL31) (1-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nephroselmis olivacea (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-215) |
Form : | Lyophilized powder |
AA Sequence : | MSKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCFGGITLTCFLIQVATGFAMTFYYRP TVTEAFASVEYIMTNVNFGWLIRSIHRWSASMMVMMLILHVFRVYLTGGFKKPRELTWVT GVILAVITVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGAPLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petB |
Synonyms | petB; Cytochrome b6 |
UniProt ID | Q9TL31 |
◆ Recombinant Proteins | ||
Adipoq-349M | Recombinant Mouse Adipoq Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP068A-011-4013S | Recombinant Staphylococcus aureus (strain: PM64, other: HA-MRSA) SAP068A_011 protein, His-tagged | +Inquiry |
SFRP1-6122C | Recombinant Chicken SFRP1 | +Inquiry |
SLC38A8-7298Z | Recombinant Zebrafish SLC38A8 | +Inquiry |
Amh-651R | Recombinant Rat Amh protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-103H | Native Human Apotransferrin | +Inquiry |
Lectin-1844S | Active Native Solanum Tuberosum Lectin Protein | +Inquiry |
Collagen type I-02H | Native Human Collagen type I Protein | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1-866HCL | Recombinant Human DNASE1 cell lysate | +Inquiry |
PPP2R2D-2922HCL | Recombinant Human PPP2R2D 293 Cell Lysate | +Inquiry |
SmallIntestine-545E | Equine Small Intestine Lysate, Total Protein | +Inquiry |
LLGL2-4720HCL | Recombinant Human LLGL2 293 Cell Lysate | +Inquiry |
UGDH-516HCL | Recombinant Human UGDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All petB Products
Required fields are marked with *
My Review for All petB Products
Required fields are marked with *
0
Inquiry Basket