Recombinant Full Length Neosartorya Fumigata Protoheme Ix Farnesyltransferase, Mitochondrial(Cox10) Protein, His-Tagged
Cat.No. : | RFL70NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Protoheme IX farnesyltransferase, mitochondrial(cox10) Protein (Q4WP81) (48-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (48-512) |
Form : | Lyophilized powder |
AA Sequence : | AGIADHESTPSTVQKTYFSANRTADGLLASLSAVNSSPRSIADNALSQGAASSESITSQS TSQELPHRRRKRLKEEAAKNNAAETELPPDASSQLSTLSSALPATSLRRKLAAFLALTKP RLSFLIVLTTTSAYGMYPISSLLTLDPSMTPLPTLSTSTLTFLYLTTGTFLSSCSANTLN MLLEPKYDALMSRTRNRPLVRGLLSRRAAVLFAIATAAAGLGLLYIGTNPTTTALSASNI CLYAFVYTPLKRISVINTWVGAVVGGIPPLMGWTAAAGQTATTGHDSWRDMLFSKDSIGG WLLGGILFAWQFPHFNALSYMIREEYKAAGYRMLAWTNPAANARVALRYSLLMFPFSVGL WWVGVVGNGFLVGSTAANGWLVKEAYKFWRHQGANGSARRLFWASIWQLPILLVGGLVTK KGLWDGVWNNVFGQPVEDEDDYLWEDEDEVAEAERKMIPAKTSSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cox10 |
Synonyms | cox10; AFUA_4G08340; Protoheme IX farnesyltransferase, mitochondrial; Heme O synthase |
UniProt ID | Q4WP81 |
◆ Recombinant Proteins | ||
COX10-980R | Recombinant Rhesus monkey COX10 Protein, His-tagged | +Inquiry |
COX10-805R | Recombinant Rhesus Macaque COX10 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX10-1992HF | Recombinant Full Length Human COX10 Protein, GST-tagged | +Inquiry |
COX10-2403C | Recombinant Chicken COX10 | +Inquiry |
RFL26004AF | Recombinant Full Length Ashbya Gossypii Protoheme Ix Farnesyltransferase, Mitochondrial(Cox10) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX10-387HCL | Recombinant Human COX10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cox10 Products
Required fields are marked with *
My Review for All cox10 Products
Required fields are marked with *
0
Inquiry Basket