Recombinant Full Length Neosartorya Fumigata Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL17538NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Palmitoyltransferase pfa5(pfa5) Protein (Q4WUK1) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MARRAADKRVNLAVSRIIPPILIGVFGYASYAITKPLCVDYLIHPAHHYDRRSRSGAGAA ILAIYYVLLIPVLATYLRLLYNVVLSPGYLPRGTACTQNQTGSDGSKHRHRRHRRRKSGH HLSKTTEKTDRSDGGDVERGLEYSARAKAYPLDAEGLESFYTKDVFVCQPDGRPVYCSTC CQFKTDRAHHCREVDRCVRKMDHFCPWVGGVVSETSFKFFIQFIVYTMIYCIFVLIVFAI YTAELRREAGRTNVHWIVCLALSSLFGFFTFGVAISSVQLAANNLTTIENLNRRSAVWTL AIRVPRHILSKRWAPTFRTITYPLPPVPPAESEVARESPGGEQHVFAILQTLPGENPFDL GSPLKNIQQVMGFSLLEWLLPIKQSPCADHSSNESAFALGPVVTRLKKEAGLEVSTESES ADPVGAAETPQHEQRRGKHRRRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pfa5 |
Synonyms | pfa5; AFUA_5G08740; Palmitoyltransferase pfa5; Protein fatty acyltransferase 5 |
UniProt ID | Q4WUK1 |
◆ Recombinant Proteins | ||
ADRa1A-3224H | Recombinant Human ADRa1A | +Inquiry |
C9orf139-0186H | Recombinant Human C9orf139 Protein, GST-Tagged | +Inquiry |
PPIH-30106TH | Recombinant Human PPIH | +Inquiry |
ADH1C-2487H | Recombinant Human ADH1C protein, GST-tagged | +Inquiry |
SDE2-14797M | Recombinant Mouse SDE2 Protein | +Inquiry |
◆ Native Proteins | ||
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
C9-58H | Native Human Complement C9 | +Inquiry |
IgD-213H | Native Human Immunoglobulin D (IgD) | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Lung-800G | Guinea Pig Lung Membrane Lysate, Total Protein | +Inquiry |
HA-876HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
C10orf82-8361HCL | Recombinant Human C10orf82 293 Cell Lysate | +Inquiry |
CTDSPL-7208HCL | Recombinant Human CTDSPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pfa5 Products
Required fields are marked with *
My Review for All pfa5 Products
Required fields are marked with *
0
Inquiry Basket