Recombinant Full Length Neosartorya Fumigata Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Tim50) Protein, His-Tagged
Cat.No. : | RFL22123NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim50(tim50) Protein (Q4WI16) (17-501aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-501) |
Form : | Lyophilized powder |
AA Sequence : | AKSSKPKAPYKLPESVKPPQSEQPSSTPKPEYSAEQTEFDTKADPAGNAAPEASEATESK PQQPLPDLTQGIPSTLAAELEGRTKKSGQTSLNLTEDPSRFEDYTDDGRGDIPKDGYVSS LDRRRARMANLMYAFFLLAGAGGVAYLGRNWETEEEAKAHPDIPSGWSFSSWYNRMKARL SDITSYYKDPAFPKLLPDEDPNLRQPYTLVLSLEDLLVHSEWSREHGWRIAKRPGVDYFL RYLNQYYELVLFTSVPSMMADQVLRKLDPYRIIRWPLFREATRYKDGEYIKDLSYLNRDL SKVILIDTKEEHARLQPENAIILDKWLGDPKDKNLVALIPFLEYIAGMGVEDVRPVLKSF EGTSIPVEFAKRERIMREKFEKELEEERKRRPKRGVGSLASALGLKSTRTLDGEQSPSEG LAQGKMLWDQIRERGQKNYEMIEKEIRENGEKWLAEMAAEEEKARQEQMKMMKGSFTSMF GAGKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tim50 |
Synonyms | tim50; AFUA_2G03420; Mitochondrial import inner membrane translocase subunit tim50 |
UniProt ID | Q4WI16 |
◆ Recombinant Proteins | ||
ACVR1-1408H | Recombinant Human Activin A Receptor, Type I | +Inquiry |
JRKL-8435M | Recombinant Mouse JRKL Protein | +Inquiry |
GPRC5D-1489H | Active Recombinant Human GPRC5D protein, Flag-His-tagged | +Inquiry |
UPK1A-3729Z | Recombinant Zebrafish UPK1A | +Inquiry |
YERQ-2906B | Recombinant Bacillus subtilis YERQ protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
LDH4-224H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
SERPINE1-5514R | Native Rabbit Serpin Peptidase Inhibitor, Clade E (nexin, plasminogen activator inhibitor type 1), Member 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RY6-3484HCL | Recombinant Human P2RY6 293 Cell Lysate | +Inquiry |
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
DMKN-1968HCL | Recombinant Human DMKN cell lysate | +Inquiry |
TMEM182-981HCL | Recombinant Human TMEM182 293 Cell Lysate | +Inquiry |
WNT3-296HCL | Recombinant Human WNT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tim50 Products
Required fields are marked with *
My Review for All tim50 Products
Required fields are marked with *
0
Inquiry Basket