Recombinant Full Length Neorickettsia Risticii Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL28240NF |
Product Overview : | Recombinant Full Length Neorickettsia risticii ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (C6V4R9) (1-636aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neorickettsia risticii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-636) |
Form : | Lyophilized powder |
AA Sequence : | MKKLLENLSLWMGIIILVTLLFGQVALNFGFGIRNEKIQFSEFLDLVEKGEVQKIVIEGY DISGVLKSGTRFYTKATQYTELIPLLRKNNVDFQVASGDSFLGLLFNILISWFPMLLLIG VWIFFMKQMQAGGNKTMTFGKSKARLLSDRSNKVTFHDVAGIDEAKEELAEIVEFLREPK KFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEAKVPFFSISGSDFVEMFVGVGASRVRD MFEQGKKNAPCLIFIDEIDAVGRHRGVGFGGGNDEREQTLNQLLVEMDGFEANEGVIIIA ATNRPDVLDPALLRPGRFDRQITISIPDIAGRQKILEVHLKKIPTAPNVEVSIIARGTPG FSGADLANLVNESALIAARRNKKVVTNEDFEYARDKILMGMERKSLVMREEEKLLTAYHE AGHAVTSLKLEASDPIHKATIIPRGRALGLVMRLPEHDRVSFTRAKMHADLIVAMGGRAA EQVIFGDDKTTSGAASDIKQATHLARSMVTKWGMSEKVGPLLYGEQNDPNNHILSIEMSN LIDSEVKQLITDALKEATKILNENIESLHRIAKALLEYETLTGQELSDLLEGKPFLKKTA DDKKVVSKSSLDVEDDTVDKETLEKLESDLDTGDKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; NRI_0402; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | C6V4R9 |
◆ Recombinant Proteins | ||
BIRC5-2593H | Recombinant Human BIRC5 protein, His-SUMO-tagged | +Inquiry |
CCNA2-6797C | Recombinant Chicken CCNA2 | +Inquiry |
Tek-1360R | Recombinant Rat Tek protein(Met4-Leu743), hFc-tagged | +Inquiry |
YWHAE-6638R | Recombinant Rat YWHAE Protein | +Inquiry |
ODF4-3327H | Recombinant Human ODF4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
C-type lectin like protein-043H | Native Hen C-type lectin like protein Protein, Peroxidase conjugated | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM59-939HCL | Recombinant Human TMEM59 293 Cell Lysate | +Inquiry |
GSTM2-5712HCL | Recombinant Human GSTM2 293 Cell Lysate | +Inquiry |
C1orf50-8157HCL | Recombinant Human C1orf50 293 Cell Lysate | +Inquiry |
ZNF750-15HCL | Recombinant Human ZNF750 293 Cell Lysate | +Inquiry |
DIRAS2-6921HCL | Recombinant Human DIRAS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket