Recombinant Full Length Neisseria Meningitidis Serogroup C Na(+)-Translocating Nadh-Quinone Reductase Subunit E Protein, His-Tagged
Cat.No. : | RFL3883NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup C Na(+)-translocating NADH-quinone reductase subunit E Protein (A9M2A7) (1-197aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria meningitidis serogroup C |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-197) |
Form : | Lyophilized powder |
AA Sequence : | MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVY SLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCA IFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFI AAGLMAMAFMSFSGIQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrE |
Synonyms | nqrE; NMCC_0511; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E |
UniProt ID | A9M2A7 |
◆ Recombinant Proteins | ||
EIF2AK1-6862HF | Active Recombinant Full Length Human EIF2AK1 Protein, GST-tagged | +Inquiry |
RPE65-2371H | Recombinant Human RPE65, His-tagged | +Inquiry |
LY6I-5256M | Recombinant Mouse LY6I Protein, His (Fc)-Avi-tagged | +Inquiry |
BIN-2058S | Recombinant Staphylococcus aureus (strain: 207, other: CA-MSSA) BIN protein, His-tagged | +Inquiry |
HA-440H | Recombinant H5N1 HA, His-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
◆ Cell & Tissue Lysates | ||
C7-1425HCL | Recombinant Human C7 cell lysate | +Inquiry |
Testis-509H | Human Testis Liver Cirrhosis Lysate | +Inquiry |
NAT6-3963HCL | Recombinant Human NAT6 293 Cell Lysate | +Inquiry |
LIMK2-4737HCL | Recombinant Human LIMK2 293 Cell Lysate | +Inquiry |
CALB1-7897HCL | Recombinant Human CALB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nqrE Products
Required fields are marked with *
My Review for All nqrE Products
Required fields are marked with *
0
Inquiry Basket