Recombinant Full Length Mannheimia Succiniciproducens Na(+)-Translocating Nadh-Quinone Reductase Subunit E(Nqre) Protein, His-Tagged
Cat.No. : | RFL2993MF |
Product Overview : | Recombinant Full Length Mannheimia succiniciproducens Na(+)-translocating NADH-quinone reductase subunit E(nqrE) Protein (Q65VU8) (1-198aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mannheimia succiniciproducens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-198) |
Form : | Lyophilized powder |
AA Sequence : | MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGISVPVNQLVY THILKDGALIEGVDLSFLNFITFIGVIAALVQILEMFLDKFVPSLYEALGIFLPLITVNC AIFGGVSFMVQREYNFPESVVYGIGAGTGWMLAIVALAGLTEKMKYADVPAGLRGLGITF ITVGLMALGFMSFSGIQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrE |
Synonyms | nqrE; MS0305; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E |
UniProt ID | Q65VU8 |
◆ Recombinant Proteins | ||
YKZI-4097B | Recombinant Bacillus subtilis YKZI protein, His-tagged | +Inquiry |
RFL19106TF | Recombinant Full Length Taterillus Emini Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
ARF6-3369H | Recombinant Human ADP-ribosylation Factor 6, His-tagged | +Inquiry |
STBD1-4521R | Recombinant Rhesus monkey STBD1 Protein, His-tagged | +Inquiry |
MRPL41-3774R | Recombinant Rat MRPL41 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
AFP-412H | Native Human AFP Protein | +Inquiry |
Prothrombin-293M | Native Mouse Prothrombin Frag-1 | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
Lectin-1752A | Active Native Aleuria Aurantia Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD6-2746HCL | Recombinant Human PSMD6 293 Cell Lysate | +Inquiry |
DPAB17737 | Rabbit Anti-TELO2 Polyclonal Antibody | +Inquiry |
NID2-1195HCL | Recombinant Human NID2 cell lysate | +Inquiry |
PTCH1-2723HCL | Recombinant Human PTCH1 293 Cell Lysate | +Inquiry |
SARNP-2062HCL | Recombinant Human SARNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nqrE Products
Required fields are marked with *
My Review for All nqrE Products
Required fields are marked with *
0
Inquiry Basket