Recombinant Full Length Neisseria Meningitidis Serogroup B Upf0761 Membrane Protein Nmb0524(Nmb0524) Protein, His-Tagged
Cat.No. : | RFL33683NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup B UPF0761 membrane protein NMB0524(NMB0524) Protein (Q9K0R0) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria Meningitidis Serogroup B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIF PVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFREQANRLTAIGSVMLVVTSLMLIRTID NTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSLGVGISFMVGSVQDAALASGAPQWSGAL RTAATLTFMTLLLWGLYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRS IYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFRRGFDSRGRFDDVLKILLLL DAAQKEGKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQGWVLKTGADSIELNEL FKLFVYRPLPVERDHVNQAVDAVMTPCLQTLNMTLAEFDAQAKKRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMB0524 |
Synonyms | NMB0524; UPF0761 membrane protein NMB0524 |
UniProt ID | Q9K0R0 |
◆ Native Proteins | ||
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
Lectin-1734U | Active Native Ulex Europaeus Agglutinin I Protein, Rhodamine labeled | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
AEBP1-8321S | Native S. cerevisiae AEBP1 | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSND-8401HCL | Recombinant Human BSND 293 Cell Lysate | +Inquiry |
SPACA4-1551HCL | Recombinant Human SPACA4 293 Cell Lysate | +Inquiry |
PDGFD-3335HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
SUDS3-1363HCL | Recombinant Human SUDS3 293 Cell Lysate | +Inquiry |
DKC1-6916HCL | Recombinant Human DKC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMB0524 Products
Required fields are marked with *
My Review for All NMB0524 Products
Required fields are marked with *
0
Inquiry Basket