Recombinant Full Length Neisseria Meningitidis Serogroup B Uncharacterized Membrane Protein Nmb1645(Nmb1645) Protein, His-Tagged
Cat.No. : | RFL24512NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup B Uncharacterized membrane protein NMB1645(NMB1645) Protein (Q9JYD0) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria Meningitidis Serogroup B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MLNPSRKLVELVRILDEGGFIFSGDPVQATEALRRVDGSTEEKIIRRAEMIDRNRMLRET LERVRAGSFWLWVVAATFAFFTGFSVTYLLMDNQGLNFFLVLAGVLGMNTLMLAVWLAML FLRVKVGRFFSSPATWFRGKDPVNQAVLRLYADEWRQPSVRWKIGATSHSLWLCTLLGML VSVLLLLLVRQYTFNWESTLLSNAASVRAVEMLAWLPSKLGFPVPDARAVIEGRLNGNIA DARAWSGLLVGSIACYGILPRLLAWVVCKILLKTSENGLDLEKPYYQAVIRRWQNKITDA DTRRETVSAVSPKIILNDAPKWAVMLETEWQDGEWFEGRLAQEWLDKGVATNREQVAALE TELKQKPAQLLIGVRAQTVPDRGVLRQIVRLSEAAQGGAVVQLLAEQGLSDDLSEKLEHW RNALAECGAAWLEPDRAAQEGRLKDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMB1645 |
Synonyms | NMB1645; Uncharacterized membrane protein NMB1645 |
UniProt ID | Q9JYD0 |
◆ Recombinant Proteins | ||
Mapre3-165M | Recombinant Mouse Mapre3 Protein, MYC/DDK-tagged | +Inquiry |
ITGA4&ITGB7-365H | Active Recombinant Human ITGA4 & ITGB7 Heterodimer Protein, His-tagged | +Inquiry |
CKS1B-1402H | Recombinant Human CKS1B Protein, GST-tagged | +Inquiry |
SCT-347H | Recombinant Human Secretin | +Inquiry |
SUN2-16241M | Recombinant Mouse SUN2 Protein | +Inquiry |
◆ Native Proteins | ||
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFHR1-1289HCL | Recombinant Human CFHR1 cell lysate | +Inquiry |
CMA1-493HCL | Recombinant Human CMA1 cell lysate | +Inquiry |
UBE2E3-580HCL | Recombinant Human UBE2E3 293 Cell Lysate | +Inquiry |
IRF2BP1-871HCL | Recombinant Human IRF2BP1 cell lysate | +Inquiry |
C1orf216-8165HCL | Recombinant Human C1orf216 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMB1645 Products
Required fields are marked with *
My Review for All NMB1645 Products
Required fields are marked with *
0
Inquiry Basket