Recombinant Full Length Neisseria Meningitidis Serogroup B Putative Zinc Metalloprotease Nmb0183(Nmb0183) Protein, His-Tagged
Cat.No. : | RFL26764NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup B Putative zinc metalloprotease NMB0183(NMB0183) Protein (Q9K1G9) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria Meningitidis Serogroup B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIP LGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGVT ELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADWGSAQTEIVLNLEAGKVAVGVQTA SGAQTVRTIDAAGTPEAGKIAKNQGYIGLMPFKITTVAGGVEKGSPAEKAGLKPGDRLTA ADGKPIASWQEWANLTRQSPGKKITLNYERAGQTHTADIRPDTVEQSDHTLIGRVGLRPQ PDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSWTTLKFFGKLISGNASVSHISGPLTIAD IAGQSAELGLQSYLEFLALVSISLGVLNLLPVPVLDGGHLVFYTAEWIRGKPLGERVQNI GLRFGLALMMLMMAVAFFNDVTRLLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMB0183 |
Synonyms | NMB0183; Putative zinc metalloprotease NMB0183 |
UniProt ID | Q9K1G9 |
◆ Recombinant Proteins | ||
Erbb2-2514MAF488 | Recombinant Mouse Erbb2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
C7orf25-6488H | Recombinant Human C7orf25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BMI1-1371H | Recombinant Human BMI1 Protein (Glu152-Ile289), His tagged | +Inquiry |
Plekha2-4925M | Recombinant Mouse Plekha2 Protein, Myc/DDK-tagged | +Inquiry |
MPI-1019H | Recombinant Human MPI, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
LOX3-185G | Native Glycine max LOX3 Protein | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
Ceruloplasmin-019B | Active Native Bovine Ceruloplasmin Protein | +Inquiry |
Ubiquitin-001 | Biotinylated Ubiquitin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTRK2-2683HCL | Recombinant Human NTRK2 cell lysate | +Inquiry |
ZC3H7A-1959HCL | Recombinant Human ZC3H7A cell lysate | +Inquiry |
SSBP3-1462HCL | Recombinant Human SSBP3 293 Cell Lysate | +Inquiry |
TOR1A-866HCL | Recombinant Human TOR1A 293 Cell Lysate | +Inquiry |
SLC9A8-1692HCL | Recombinant Human SLC9A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMB0183 Products
Required fields are marked with *
My Review for All NMB0183 Products
Required fields are marked with *
0
Inquiry Basket