Recombinant Full Length Neisseria Meningitidis Serogroup A / Serotype 4A Lipoprotein-Releasing System Transmembrane Protein Lolc(Lolc) Protein, His-Tagged
Cat.No. : | RFL15505NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup A / serotype 4A Lipoprotein-releasing system transmembrane protein LolC(lolC) Protein (P57061) (1-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria meningitidis serogroup A / serotype 4A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-415) |
Form : | Lyophilized powder |
AA Sequence : | MFSLEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLN VAPHAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQALLANAGEIRGVQIRGILPS EERKVVEYGDKMPAGKFEDLIPGEFDIILGVGLAEALGAEVGNKVTVITPEGNVTPAGVV PRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPALTAK LIPEAQRDTVWVRDWTFSNRSYFEAVELEKRMMFIILTLIIAVAAFNLVSSLVMAVTEKQ ADIAILRTLGLSPGGVMKIFMVQGAFSGFFGTLAGVVCGVLLGWNVGRVVAFFENLLGVH LINSQVYFIDYLPSDVDMGDVALIACISLGLSFVATLYPSRRASKTQPAEALRYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lolC |
Synonyms | lolC; NMA1403; Lipoprotein-releasing system transmembrane protein LolC |
UniProt ID | P57061 |
◆ Recombinant Proteins | ||
WDR46-10135M | Recombinant Mouse WDR46 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il4-648R | Recombinant Rat Il4 protein, His & GST-tagged | +Inquiry |
CMTM1-1543H | Recombinant Human CMTM1 Protein, GST-tagged | +Inquiry |
TRPV4-6258C | Recombinant Chicken TRPV4 | +Inquiry |
RFL5665GF | Recombinant Full Length Gnetum Parvifolium Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
Hyaluronidase-34O | Active Native Ovine Hyaluronidase | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
VTN-5410H | Native Human Vitronectin | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MANSC1-4518HCL | Recombinant Human MANSC1 293 Cell Lysate | +Inquiry |
MYLIP-4018HCL | Recombinant Human MYLIP 293 Cell Lysate | +Inquiry |
EDN3-6719HCL | Recombinant Human EDN3 293 Cell Lysate | +Inquiry |
STAU2-1413HCL | Recombinant Human STAU2 293 Cell Lysate | +Inquiry |
OSCAR-3527HCL | Recombinant Human OSCAR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lolC Products
Required fields are marked with *
My Review for All lolC Products
Required fields are marked with *
0
Inquiry Basket