Recombinant Full Length Buchnera Aphidicola Subsp. Acyrthosiphon Pisum Lipoprotein-Releasing System Transmembrane Protein Lolc(Lolc) Protein, His-Tagged
Cat.No. : | RFL34558BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Acyrthosiphon pisum Lipoprotein-releasing system transmembrane protein LolC(lolC) Protein (P57382) (1-399aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera aphidicola subsp. Acyrthosiphon pisum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-399) |
Form : | Lyophilized powder |
AA Sequence : | MYKPISLFIALRYLWNTHLPNFKKIITILSIIGISITTASLIIITSIINGSEKNFEKNIL SFIPHLIITNKNQCIKKDQFPENILKLNNIKNISDLISKEIIVQSKNDISMAEVIGIDHT NYYNIHNYNIKSVLKTLKPGYYNIIIGKQLARKLNVFIGDRLKLIFLSNTKNFFSGEIFK QRTFKIINFFSTKKEVDYYQILMNKEDSLNFLNYSKDYVTGWRVWLKNPLSLNVNEIKKI THPLFLLDWTTQKGELFKAMKIEKYIMFLFLFLVLLVSILNIVVILTICTVEKQNAVAIL QTQGLLNCKIMLIFIIFGSSTAIIGNILGTLISLTLIIQNDFLKFFINIFIDETNIPIIV IPYQIFFINITITLFTILSTLYPSWKAIQLKPSRILSNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lolC |
Synonyms | lolC; BU295; Lipoprotein-releasing system transmembrane protein LolC |
UniProt ID | P57382 |
◆ Native Proteins | ||
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1B-851HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
RPRD1A-2177HCL | Recombinant Human RPRD1A 293 Cell Lysate | +Inquiry |
IL17D-852HCL | Recombinant Human IL17D cell lysate | +Inquiry |
PGLYRP3-3253HCL | Recombinant Human PGLYRP3 293 Cell Lysate | +Inquiry |
RND3-2312HCL | Recombinant Human RND3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lolC Products
Required fields are marked with *
My Review for All lolC Products
Required fields are marked with *
0
Inquiry Basket