Recombinant Full Length Natronomonas Pharaonis Protein Crcb Homolog 2(Crcb2) Protein, His-Tagged
Cat.No. : | RFL4503NF |
Product Overview : | Recombinant Full Length Natronomonas pharaonis Protein CrcB homolog 2(crcB2) Protein (Q3IUS6) (1-116aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Natronomonas pharaonis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-116) |
Form : | Lyophilized powder |
AA Sequence : | MALLTALAVGAGGAAGAVARYAVGLSVGRRAVDTGLVNVFGSLLFGVAIGADFGGAPAVA VTVGFCGAFTTFSSFAVETVRLAEDGQRLAAAGNAVGTLAAALLAVFLGIALGAAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crcB2 |
Synonyms | crcB2; NP_0026A; Putative fluoride ion transporter CrcB 2 |
UniProt ID | Q3IUS6 |
◆ Recombinant Proteins | ||
Lif-719M | Active Recombinant Mouse Lif, His-tagged, Biotinylated | +Inquiry |
SLC35B1-5174R | Recombinant Rat SLC35B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YQJT-3817B | Recombinant Bacillus subtilis YQJT protein, His-tagged | +Inquiry |
NCR1-3924R | Recombinant Rat NCR1 Protein | +Inquiry |
Colloidal gold-010 | Nonconjugated Colloidal gold | +Inquiry |
◆ Native Proteins | ||
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPLX4-7311HCL | Recombinant Human CPLX4 293 Cell Lysate | +Inquiry |
GTF2IRD1-5691HCL | Recombinant Human GTF2IRD1 293 Cell Lysate | +Inquiry |
HTRA4-5328HCL | Recombinant Human HTRA4 293 Cell Lysate | +Inquiry |
RASL10A-2502HCL | Recombinant Human RASL10A 293 Cell Lysate | +Inquiry |
ANKRD39-8850HCL | Recombinant Human ANKRD39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crcB2 Products
Required fields are marked with *
My Review for All crcB2 Products
Required fields are marked with *
0
Inquiry Basket