Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg255 Homolog (Mpn_358) Protein, His-Tagged
Cat.No. : | RFL29985MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Uncharacterized protein MG255 homolog (MPN_358) Protein (P75422) (1-534aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-534) |
Form : | Lyophilized powder |
AA Sequence : | METQNQIETLRYIFNQLNNQDKPQIIWFSGEGEDEKINFLIRLDNYFQPTFVQDLTINFL PAFVKRNKKNPPNTLAKGNFVNIANKLLAVLARSLSWKQLNKPQQKWLLWLLVPFLLLRQ LWLKKKVSKIFQFVNERGILSFIKEQWPILTTLVTVGTTLGTPIFSITISQQKAILENAG HGAFVFLVIFSVFAIALGLVSSLIFLVSSLFSIRQKKSLQQLHQILSRLINKYFCFANSE QNQTGRYQLKNTGVCFFYGFDFEEKEYITQAMNLLLLLKQTNCFVLVGCKESNMLLIKNK VEPDINLKQSSLYLDLKSQISPLAQISKYNLLFEELALDADMFYLEDFFALLKTPRQIVN FLFRIKQNLKEFHQPQTLWFDYLALWALVIATDFEFNNVLWSFNDYLSLTNKQKEDYASV NLTAFFNRSLKNHKDNSLLFKPELFNTHAYIPETYTQVTLENIDSDKRAQLVPLNWFSQQ KFSDFIEEKINFWQTQQAENKVFYLTLGERIFFLVLVNKKFKQIKLEAALKYLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_358 |
Synonyms | MPN_358; H91_orf534; MP478; Uncharacterized protein MG255 homolog |
UniProt ID | P75422 |
◆ Recombinant Proteins | ||
AYP1020-RS11060-4782S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS11060 protein, His-tagged | +Inquiry |
THOC7-881Z | Recombinant Zebrafish THOC7 | +Inquiry |
HIGD1B-3629H | Recombinant Human HIGD1B protein, His-tagged | +Inquiry |
SHROOM2-8164M | Recombinant Mouse SHROOM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP1B1-2116M | Recombinant Mouse ATP1B1 Protein | +Inquiry |
◆ Native Proteins | ||
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
CNTF-26839TH | Native Human CNTF | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
LDL-242H | Native Human Lipoproteins, High Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMRAL1-3784HCL | Recombinant Human NMRAL1 293 Cell Lysate | +Inquiry |
CASP8-7829HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
CTSL1-3022HCL | Recombinant Human CTSL1 cell lysate | +Inquiry |
TMEM110-673HCL | Recombinant Human TMEM110 lysate | +Inquiry |
LGALS8-4762HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MPN_358 Products
Required fields are marked with *
My Review for All MPN_358 Products
Required fields are marked with *
0
Inquiry Basket