Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg181 Homolog(Mpn_195) Protein, His-Tagged
Cat.No. : | RFL29783MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Uncharacterized protein MG181 homolog(MPN_195) Protein (Q50292) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MDSFFINGYVPRDTFIHRLHPTTKLLIFLLFVILVFVPIGFVFQSVIFVFATVIFFVAKL PGRFYLSSIKSISLLFLLLLFVNWFTFRDPGFYITADQVNTVKPHFNGNNFNFWNISLFN YQDNVFSQVFNFNRANMTELNKINFFFKETANANAYTKVTGIDKLAEMLASKNLFKFNGS TNGIDKNKILGAFLDHKIAVYLGRSWGGDFSGFVIDVSVSDKTSTFTIKPFLANSNYVLT LRAIILAFYVTQKILIMIILATVLTSTSSSVELAYGIERLLWPLKLLRVPVNVFAMTIAI AIRFVPSLLLESQRILNAQASRGLDFKNGNFFVKMRSLSSLVVPMISIAFRNAGELASAM EARGYDPTKKRTTYRKFKIDWVDATALILTALYFVVIIFLTVKGAVFLDLGTPEWLLTGK IKEQVERSLSVKSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_195 |
Synonyms | MPN_195; GT9_orf434; MP636; Uncharacterized protein MG181 homolog |
UniProt ID | Q50292 |
◆ Recombinant Proteins | ||
CCDC106-2810M | Recombinant Mouse CCDC106 Protein | +Inquiry |
SMYD5-1333Z | Recombinant Zebrafish SMYD5 | +Inquiry |
GTF3C4-2013R | Recombinant Rhesus monkey GTF3C4 Protein, His-tagged | +Inquiry |
Dapp1-1656M | Recombinant Mouse Dapp1 protein, His & T7-tagged | +Inquiry |
RFL11159CF | Recombinant Full Length Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
DD-170H | Active Native Human D-Dimer | +Inquiry |
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EME1-552HCL | Recombinant Human EME1 cell lysate | +Inquiry |
CRP-1945RCL | Recombinant Rat CRP cell lysate | +Inquiry |
DDI2-220HCL | Recombinant Human DDI2 lysate | +Inquiry |
POLE3-1391HCL | Recombinant Human POLE3 cell lysate | +Inquiry |
IRAK1-5173HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPN_195 Products
Required fields are marked with *
My Review for All MPN_195 Products
Required fields are marked with *
0
Inquiry Basket