Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg144 Homolog (Mpn_157) Protein, His-Tagged
Cat.No. : | RFL7866MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Uncharacterized protein MG144 homolog (MPN_157) Protein (P75588) (1-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-402) |
Form : | Lyophilized powder |
AA Sequence : | MKPPKKPVNPPFGKLTDSKAGVVKATSSQETKKVADTKPKNKGGLFSFFKKDKTEKPAKA AKPKDAFKSAIAELNPKANPKTVKADVAPAKIPHSDKGTVTPVELKPQTEAPLPPGVKQP DPKKDKPKGGLFGFFKKDKNKDVKKEPAKPATPVKTEPTSPKVEPTKVKPPGGVPTKPVV EKPVSAQPTVPLQPEPTFPVKAAPLPPGVKAEPESKKRFGLFKAFQKDDAKQPKQKLNLQ DQQDRFIDDPTAKKHFSAFNQKVGNLLKDKKTRNRDWKIVGWIHGLILLFFIPLLAIMNK FVTLPAQSYPAVSLQVSINNALWGIAIFVIANIALPFITMFVLFLTGVRDVHASRPVHYF IWVLMLLNLTFLVISCCLLAAAYANLDLYNIWRNLQALDPNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_157 |
Synonyms | MPN_157; MP674; VXpSPT7_orf402; Uncharacterized protein MG144 homolog |
UniProt ID | P75588 |
◆ Recombinant Proteins | ||
GUCA2A-2542H | Recombinant Human GUCA2A Protein, MYC/DDK-tagged | +Inquiry |
LOXL2-3089R | Recombinant Rat LOXL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GID8-1668R | Recombinant Rhesus Macaque GID8 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRK7B-3379Z | Recombinant Zebrafish GRK7B | +Inquiry |
CD47-380M | Recombinant Mouse CD47 protein (Met1-Lys140) | +Inquiry |
◆ Native Proteins | ||
C3b-06M | Native Mouse C3b Protein | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYTL1-648HCL | Recombinant Human SYTL1 lysate | +Inquiry |
SLC5A7-1707HCL | Recombinant Human SLC5A7 293 Cell Lysate | +Inquiry |
PLCB2-483HCL | Recombinant Human PLCB2 lysate | +Inquiry |
PPAPDC1A-2990HCL | Recombinant Human PPAPDC1A 293 Cell Lysate | +Inquiry |
DKK4-6915HCL | Recombinant Human DKK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MPN_157 Products
Required fields are marked with *
My Review for All MPN_157 Products
Required fields are marked with *
0
Inquiry Basket