Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg123 Homolog (Mpn_262) Protein, His-Tagged
Cat.No. : | RFL17749MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Uncharacterized protein MG123 homolog (MPN_262) Protein (P75513) (1-475aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-475) |
Form : | Lyophilized powder |
AA Sequence : | MLASLTSRSATSFSIIWALVSAILILSILIWLIITIFFAWNLHLKNNKKRTKYHLEPEQI KHKIIQNKTKLGKMLDFYQQQINTTATELKWLDGQFQQIDETDKKKAHQIAIRLARNQLL QQLSVKLDQKQFSQRANNELQKLKLSNLESFTNQKIKWDQEGMKSAVSRVTINEWTFNHF AGKNRVYWDYFKQVCDVDCSIKPLKDQLEITFSSWSLLKRLQAKNLFNKLIAQSSSVKMS EKLINNALQLVQDNLALQASESGNKLLKEFELSCTNTQLVQLLGFQQFYFGTNLLSLLDL SRSIAVLVRFLNEHCKWELNERLLVETALFNNLQWVNNNDFFLKSHNDLKQLHLSAEQLA IIEQQNRPFYIDAYALLIAGVKQMLMEHDAVEPKQIHFHNAKKVMESFQLFGIDQLALIE YNNCLYGFVTTKLYEIKQLDDLALFKVLFKSFLNKHLKQKFATISLFVNTQTLMI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_262 |
Synonyms | MPN_262; A65_orf475; MP571; Uncharacterized protein MG123 homolog |
UniProt ID | P75513 |
◆ Recombinant Proteins | ||
MYO1G-3560H | Recombinant Human MYO1G Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPK-3288M | Recombinant Mouse CENPK Protein | +Inquiry |
MEST-8671Z | Recombinant Zebrafish MEST | +Inquiry |
TSPAN31-5983R | Recombinant Rat TSPAN31 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRKL-6088H | Recombinant Human CRKL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5H-8599HCL | Recombinant Human ATP5H 293 Cell Lysate | +Inquiry |
ZBTB44-214HCL | Recombinant Human ZBTB44 293 Cell Lysate | +Inquiry |
THEM5-1097HCL | Recombinant Human THEM5 293 Cell Lysate | +Inquiry |
GOLGA1-725HCL | Recombinant Human GOLGA1 cell lysate | +Inquiry |
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPN_262 Products
Required fields are marked with *
My Review for All MPN_262 Products
Required fields are marked with *
0
Inquiry Basket