Recombinant Full Length Mycoplasma Pneumoniae Putative Abc Transporter Atp-Binding Protein Mg014 Homolog (Mpn_018) Protein, His-Tagged
Cat.No. : | RFL30273MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Putative ABC transporter ATP-binding protein MG014 homolog (MPN_018) Protein (P75095) (1-623aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-623) |
Form : | Lyophilized powder |
AA Sequence : | MGLVLKQFNRKIRTALILAPLFTFAQIIIDLIIPSFLASAIAVVFSIVTLKQKEASGEGV AVDFIAESKLSFQSVQEAQIVLATSVILLALFGLVFGLISIFCASIVAGNTSYFLRRKIF RKIMHITAPSHDQYGSSTLLVRLTNDVYLMEIMTFDFLRLIVRAPFLFIGGLAFAIATNS DMSISLAITFPLTFLVIGILNKKSTPLFKNNQKSVDQINERVEEDVSGYKVVQSFNLKDT ECLKFKAANARWTKSSTNSLFVNTLNIPFTFFFSSMTIIIALLLVFQLDNSVRVDPLPDN AAIRPSIFAFFQYNFYIVLGLILTSLTMVNFTRSRVALGRIKDVLNKPEIQQHVVPDQTV LAPSLEFKNVAFGLGNKENRDFLQDLNFKFEAGKTYGIVGPTGSGKSLIANIIGGLYEPN QGEIFVGGQSIKTIDSDYLAKMIGIVFQQNILFKGTIASNIKIGLETREDWKHEPDSKKD AAMKRAAAIACADTFIEKFSDTYDHTVEQLGKNLSGGQKQRVAIARTVITKPQILVLDDS MSALDALTEKKVRENIANELPGTTKIIISQNINSIKYAHKIMVIDNGRIAGFDSDAKLMQ SCDIYVKMKQAQKDQGGDFDAVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_018 |
Synonyms | MPN_018; D12_orf623; MP136; Putative ABC transporter ATP-binding protein MG014 homolog |
UniProt ID | P75095 |
◆ Recombinant Proteins | ||
PFN1-783C | Recombinant Cynomolgus PFN1 Protein, His-tagged | +Inquiry |
SCN2B-310H | Recombinant Human SCN2B, His tagged | +Inquiry |
KLHL18-2648C | Recombinant Chicken KLHL18 | +Inquiry |
RFL10312PF | Recombinant Full Length Pan Troglodytes Glycophorin-B(Gypb) Protein, His-Tagged | +Inquiry |
HSPB9-2260H | Recombinant Human HSPB9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RWX-308S | Native Snake RVV-X ACTIVATOR | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
Fgg -69R | Native Rat Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRNP70-1620HCL | Recombinant Human SNRNP70 293 Cell Lysate | +Inquiry |
TCEAL7-658HCL | Recombinant Human TCEAL7 lysate | +Inquiry |
SCIN-1568HCL | Recombinant Human SCIN cell lysate | +Inquiry |
CCDC87-7744HCL | Recombinant Human CCDC87 293 Cell Lysate | +Inquiry |
DLL1-2029MCL | Recombinant Mouse DLL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPN_018 Products
Required fields are marked with *
My Review for All MPN_018 Products
Required fields are marked with *
0
Inquiry Basket