Recombinant Full Length Mycoplasma Genitalium Uncharacterized Protein Mg423 (Mg423) Protein, His-Tagged
Cat.No. : | RFL34655MF |
Product Overview : | Recombinant Full Length Mycoplasma genitalium Uncharacterized protein MG423 (MG423) Protein (P47662) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma genitalium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MAKIKFFALGGQDERGKNCYVLEIDNDVFIFNVGSLTPTTAVLGVKKIIPDFSWIQENQA RVKGIFIGNAITENLGSLEFLFHTVGFFPIYTSSIGASIIKSKINENKLNIARDKLEIHE LKPLETIEISNHSITPFKVSSSLPSSFGFALNTDNGYIVFIDDFIVLNDKNIAFENQLNQ IIPKLSDNTLLLITGVGLVGRNSGFTTPKHKSLEQLNRIITPAKGRIFVACYDSNAYSVM TLAQIARMQNRPFIIYSQSFVHLFNTIVRQKLFNNTHLNTISIEEINNSTNSIVVLTSPP DKLYAKLFKIGMNEDERIRYRKSDTFIFMTPKVAGYEEIEAQILDDIARNEVSYYNLGRE ILSIQASDEDMKFLVSSLKPKYIIPTGGLYRDFINFTMVLKQAGAEQNQILILFNGEVLT IENKKLDSKKNELKLNPKCVDSAGLQEIGASIMFERDQMSESGVVIIIIYFDQKKSEFLN EITYSFLGVSLDVPEKDKLKTKMEELIKKQINDIKDFTTIKKRIGKEISKELKVSIKRAV MNLFTKMTSKAPLILSTIISI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MG423 |
Synonyms | MG423; Uncharacterized protein MG423 |
UniProt ID | P47662 |
◆ Recombinant Proteins | ||
PCYT1AA-2404Z | Recombinant Zebrafish PCYT1AA | +Inquiry |
TSSC4-3467H | Recombinant Human TSSC4, GST-tagged | +Inquiry |
UREB-1201S | Recombinant Staphylococcus epidermidis ATCC 12228 UREB protein, His-tagged | +Inquiry |
LGALS12-9061M | Recombinant Mouse LGALS12 Protein | +Inquiry |
IRF1-128H | Recombinant Human IRF1 protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
SERPIND1-12H | Native Human Heparin Cofactor II | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC43-157HCL | Recombinant Human CCDC43 lysate | +Inquiry |
BoneMarrow-455C | Cat Bone Marrow Lysate, Total Protein | +Inquiry |
TRDD3-1819HCL | Recombinant Human TRDD3 cell lysate | +Inquiry |
DAP3-7077HCL | Recombinant Human DAP3 293 Cell Lysate | +Inquiry |
SEC63-1988HCL | Recombinant Human SEC63 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MG423 Products
Required fields are marked with *
My Review for All MG423 Products
Required fields are marked with *
0
Inquiry Basket