Recombinant Full Length Mycoplasma Genitalium Uncharacterized Protein Mg242 (Mg242) Protein, His-Tagged
Cat.No. : | RFL15436MF |
Product Overview : | Recombinant Full Length Mycoplasma genitalium Uncharacterized protein MG242 (MG242) Protein (P47484) (1-630aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma genitalium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-630) |
Form : | Lyophilized powder |
AA Sequence : | MKFNKLNLSHCISFYISEVSEVFFESINQHPSRDFVNNILQKIKTTLSEEELEKLNSIEE VTKDEKIVIMLNHVLKKIVSKTGSSKCDLFNVIKQDRFNSPVYIQSINAFENNLINNEFA ERRYDYLIEVNKNSYLKKFVNSIRISFFLDLRAQILSGSFTLNLVNKSIEKQKKTEIFKD IFVNALVKHFICNQLYPISLNSFIFDSENPSNKLALKERIKLLKTNWNSLFFDKFYNCLN NKNKQQLQETSDEMFYAVINTYLIMLISVEELRVYFTSKEPALILKVLDKKNTLREDPDQ NPETDLYELIQFIEQNYLKKDKKTSWNKKKVQDLEQLLEEINKINLETKNESLAYPDEIT ELEIDNDNFVSTKQVFRNQLELQLLHGIVINPEKYGIGMWSSYFADWSEYKNLIEQMLNP KSGNDFYQFEKDIDESICQINKKYLTFISSDSNTFLIVKNDDVKVISNYVWAQLFFETRR WIINDIEFDLYEKGFDKSHFSRNIALLESLSFSWLDPFYGLTSIKEIMQKIDSKSNLKTS IEEMVNRFKHEQRINKKDNERVLMIFAYIAAFVVGFINFFSMVFTILTVSDLNAGLTVPN IIVISIASVLAFILIVIAVLFRFKWKHIKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MG242 |
Synonyms | MG242; Uncharacterized protein MG242 |
UniProt ID | P47484 |
◆ Recombinant Proteins | ||
MMP2-800H | Recombinant Human MMP2 Protein, His-tagged | +Inquiry |
p3834090H | Recombinant Human p38 (1-360) Protein | +Inquiry |
SERPINA1-1841H | Recombinant Human SERPINA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAMKK1-1390H | Recombinant Human CAMKK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDK16-1009H | Recombinant Human CDK16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
CVF-01I | Native purified cobra venom factor | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDELR2-5000HCL | Recombinant Human KDELR2 293 Cell Lysate | +Inquiry |
ZIK1-163HCL | Recombinant Human ZIK1 293 Cell Lysate | +Inquiry |
EXOSC8-6498HCL | Recombinant Human EXOSC8 293 Cell Lysate | +Inquiry |
UCP2-525HCL | Recombinant Human UCP2 293 Cell Lysate | +Inquiry |
NDOR1-3933HCL | Recombinant Human NDOR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MG242 Products
Required fields are marked with *
My Review for All MG242 Products
Required fields are marked with *
0
Inquiry Basket