Recombinant Full Length Mycobacterium Vanbaalenii Upf0353 Protein Mvan_2751 (Mvan_2751) Protein, His-Tagged

Cat.No. : RFL4746MF
Product Overview : Recombinant Full Length Mycobacterium vanbaalenii UPF0353 protein Mvan_2751 (Mvan_2751) Protein (A1T8Q8) (1-335aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mycobacterium vanbaalenii
Source : E.coli
Tag : His
Protein Length : Full Length (1-335)
Form : Lyophilized powder
AA Sequence : MTLPLLGPMSLSGFEHPWFFLFFLVVLGLVALYVIVQMGRHRRMLRFANMELLESVAPKR PSRWRHLPAVLLILSLMSFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVAPNRLV AAQEAAKQFADQLTPGINLGLIAYAGTATVLVSPTTNREATKAAIDKLQLADRTATGEGI FTALQAVATVGAVIGGGDEPPPARIVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPIS TVSFGTPYGYVEINDQRQPVPVDDEMLKKIADLSGGDAFTASSLEQLKQVFTNLQEQIGY ETIKGDASVGWLRIGSLVLALAALGALLINRRLPN
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Mvan_2751
Synonyms Mvan_2751; UPF0353 protein Mvan_2751
UniProt ID A1T8Q8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Mvan_2751 Products

Required fields are marked with *

My Review for All Mvan_2751 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon