Recombinant Full Length Mycobacterium Sp. Upf0353 Protein Mkms_2500 (Mkms_2500) Protein, His-Tagged
Cat.No. : | RFL35162MF |
Product Overview : | Recombinant Full Length Mycobacterium sp. UPF0353 protein Mkms_2500 (Mkms_2500) Protein (A1UFT9) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MTLPLLGPMSFSGFEHPWFFLFLIVVLALAGLYVIVALARQRRILRFANMELLESVAPNR PNRWRHLPAILLVASLVLLTVAMAGPTRDVRVPRNRAVVMLVIDVSQSMRATDVSPSRLA AAQEASKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKTAIDKLQLADRTATGEGI FTALQAIATVGAVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANLQQQIGY ETIKGDASVGWLRLGALVLALSALAALLLNRRLPG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mkms_2500 |
Synonyms | Mkms_2500; UPF0353 protein Mkms_2500 |
UniProt ID | A1UFT9 |
◆ Recombinant Proteins | ||
GLRA1-4344H | Recombinant Human GLRA1 protein, His&Myc-tagged | +Inquiry |
CYP2E1-450H | Recombinant Human CYP2E1 | +Inquiry |
RFL13598KF | Recombinant Full Length Kluyveromyces Lactis Serine Palmitoyltransferase 2(Lcb2) Protein, His-Tagged | +Inquiry |
Capsid protein VP2-5611P | Recombinant Porcine parvovirus Capsid protein VP2 Protein (Full Length), N-His tagged | +Inquiry |
TMEM189-4509C | Recombinant Chicken TMEM189 | +Inquiry |
◆ Native Proteins | ||
HP-133B | Native Bovine Haptoglobin | +Inquiry |
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF212-121HCL | Recombinant Human ZNF212 293 Cell Lysate | +Inquiry |
A431-05HL | A431 Cell Nuclear Extract | +Inquiry |
SEC22A-1996HCL | Recombinant Human SEC22A 293 Cell Lysate | +Inquiry |
STK24-490HCL | Recombinant Human STK24 cell lysate | +Inquiry |
NUDT6-3641HCL | Recombinant Human NUDT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Mkms_2500 Products
Required fields are marked with *
My Review for All Mkms_2500 Products
Required fields are marked with *
0
Inquiry Basket