Recombinant Full Length Mycobacterium Smegmatis Gdp-Mannose-Dependent Alpha-(1-2)-Phosphatidylinositol Mannosyltransferase Protein, His-Tagged
Cat.No. : | RFL26857MF |
Product Overview : | Recombinant Full Length Mycobacterium smegmatis GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase Protein (A0QWG6) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Smegmatis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVPI PYNGSVARLRFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTS TTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPL LDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGD LAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRR VLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVY ETVSGAGIKVQVSGAANRDETAGESV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pimA |
Synonyms | pimA; MSMEG_2935; MSMEI_2861; Phosphatidyl-myo-inositol mannosyltransferase; Alpha-mannosyltransferase; GDP-mannose-dependent alpha-(1-2-phosphatidylinositol mannosyltransferase; Guanosine diphosphomannose-phosphatidyl-inositol alpha-mannosyltransferase; |
UniProt ID | A0QWG6 |
◆ Recombinant Proteins | ||
QDPR-2090H | Recombinant Full Length Human QDPR Protein, His-tagged | +Inquiry |
PCDH18-12422M | Recombinant Mouse PCDH18 Protein | +Inquiry |
C5-0275H | Recombinant Human C5 Protein (Asp822-Lys925), N-His-tagged | +Inquiry |
APOA4-0598H | Recombinant Human APOA4 Protein (Glu21-Ser396), N-His-tagged | +Inquiry |
IL37-3514H | Recombinant Human IL37 Protein (Val46-Asp218), His tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type Ⅱ-525B | Native Bovine Type Collagen Type Ⅱ Protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
TOD-43 | Active Native Tyramine Oxidase | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2CD2-238HCL | Recombinant Human C2CD2 cell lysate | +Inquiry |
TTC32-679HCL | Recombinant Human TTC32 293 Cell Lysate | +Inquiry |
BIRC7-8448HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
PCDHGB4-3387HCL | Recombinant Human PCDHGB4 293 Cell Lysate | +Inquiry |
TMEM222-963HCL | Recombinant Human TMEM222 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pimA Products
Required fields are marked with *
My Review for All pimA Products
Required fields are marked with *
0
Inquiry Basket