Recombinant Full Length Mycobacterium Leprae Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL15070MF |
Product Overview : | Recombinant Full Length Mycobacterium leprae Prolipoprotein diacylglyceryl transferase(lgt) Protein (B8ZRC2) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MTRMLPGYFPSPPRGVWHLGPLPIRAYALLIILGIVAALVVGGRCWEARGGERDVTYDIA LWAVPFGLVGGRLYHLATDWRTYFGQNGAGLGAALRIWDGGLGIWGAVALGCVGAWLGCR RHRIPLPAFGDALAPGIILAQAIGRLGNYFNQELYGRETTMPWGLEVFYRRDPAGYMDPH SLDGVSTGQLAFVVQPTFLYELIWNVLVFFALIYVDRWFTLGHGRLFATYVAAYCIGRFC VELLRDDAATHIAGIRINSFTSTFVFIGAVVYIILAPKGREEPENLCRAEYVAREIPEPE SATERATVASTYATTTAVPVSADEEFAETN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; MLBr01274; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | B8ZRC2 |
◆ Recombinant Proteins | ||
NDUFC1-5986M | Recombinant Mouse NDUFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EBF4-3023H | Recombinant Human EBF4 Protein, GST-tagged | +Inquiry |
GLYR1-1006H | Recombinant Human GLYR1 | +Inquiry |
Abcb1b-2546R | Recombinant Rat Abcb1b | +Inquiry |
DCTN3-437Z | Recombinant Zebrafish DCTN3 | +Inquiry |
◆ Native Proteins | ||
IgA-245R | Native Rat Immunoglobulin A | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFS1-316HCL | Recombinant Human WFS1 293 Cell Lysate | +Inquiry |
SERPINA3-2522HCL | Recombinant Human SERPINA3 cell lysate | +Inquiry |
Pancreas-567M | MiniPig Pancreas Lysate, Total Protein | +Inquiry |
GCNT2-5979HCL | Recombinant Human GCNT2 293 Cell Lysate | +Inquiry |
GLYATL2-5888HCL | Recombinant Human GLYATL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket