Recombinant Full Length Mycobacterium Bovis Upf0353 Protein Jty_1518 (Jty_1518) Protein, His-Tagged
Cat.No. : | RFL8899MF |
Product Overview : | Recombinant Full Length Mycobacterium bovis UPF0353 protein JTY_1518 (JTY_1518) Protein (C1ANC7) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEIDDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY ETIKGDASVGWLRLGALALALAALAALLINRRLPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | JTY_1518 |
Synonyms | JTY_1518; UPF0353 protein JTY_1518 |
UniProt ID | C1ANC7 |
◆ Native Proteins | ||
PRSS7-42P | Native Porcine Enterokinase | +Inquiry |
ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2336HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
C7orf61-7958HCL | Recombinant Human C7orf61 293 Cell Lysate | +Inquiry |
CNRIP1-7393HCL | Recombinant Human CNRIP1 293 Cell Lysate | +Inquiry |
TBPL1-1209HCL | Recombinant Human TBPL1 293 Cell Lysate | +Inquiry |
SHCBP1-1860HCL | Recombinant Human SHCBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JTY_1518 Products
Required fields are marked with *
My Review for All JTY_1518 Products
Required fields are marked with *
0
Inquiry Basket