Recombinant Full Length Muscarinic Acetylcholine Receptor Gar-3(Gar-3) Protein, His-Tagged
Cat.No. : | RFL8533CF |
Product Overview : | Recombinant Full Length Muscarinic acetylcholine receptor gar-3(gar-3) Protein (Q9U7D5) (1-611aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-611) |
Form : | Lyophilized powder |
AA Sequence : | MQSSSLGNADDPRFRQTHLFQMLVKVINTSAENATKTAIATSSTSTPSFVDTYSTSSLLG EEGRMVMIVVIGAMFALVTSLGNLMVMVSFKIDKQLQTISNYFLFSLAVADIAIGVISIP MFTYYTAIQKWDLGYTMCQFWLCIDYLMSNASVLNLLLISFDRYFSVTRPLSYRPRRTTK KALTMIACTYIISLILWPPWIISWPYIEGKFTAEPGTCVVQFLQTNPYVTVGTAVAAFYL PVTIMCILYTRVYWETQKRQKEFGKLQATQTWASDVVDRPSTQSFRNSKMWKKVKKFSRR SMKRDVSSTSIIKSSGSMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGKSNSSSED SSEAVAMNLDDTSLSSSHFALSGSRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER RHSLLNKQSPFKNGRILKNFSSQERKSEKEQRKNERKQESKAAKTLSAILCAFIATWTPY NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER PTMNQGYVRRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gar-3 |
Synonyms | gar-3; Y40H4A.1; Muscarinic acetylcholine receptor gar-3; G-protein-linked acetylcholine receptor 3 |
UniProt ID | Q9U7D5 |
◆ Recombinant Proteins | ||
Tg-6386M | Recombinant Mouse Tg Protein, Myc/DDK-tagged | +Inquiry |
Ginm1-3209M | Recombinant Mouse Ginm1 Protein, Myc/DDK-tagged | +Inquiry |
BRCC3-328H | Recombinant Human BRCC3 Protein, GST-tagged | +Inquiry |
MAGOH-30169TH | Recombinant Human MAGOH, His-tagged | +Inquiry |
EIF3E-2059R | Recombinant Rat EIF3E Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1830R | Active Native Ricinus Communis Agglutinin I Protein, Agarose bound | +Inquiry |
COL3A1-17B | Native Bovine COL3A1 Protein | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
SNCB-27206TH | Native Human SNCB | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB6-5347HCL | Recombinant Human HSPB6 293 Cell Lysate | +Inquiry |
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
NPEPL1-3744HCL | Recombinant Human NPEPL1 293 Cell Lysate | +Inquiry |
MAPK10-4499HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gar-3 Products
Required fields are marked with *
My Review for All gar-3 Products
Required fields are marked with *
0
Inquiry Basket