Recombinant Full Length Mouse Visual Pigment-Like Receptor Peropsin(Rrh) Protein, His-Tagged
Cat.No. : | RFL27105MF |
Product Overview : | Recombinant Full Length Mouse Visual pigment-like receptor peropsin(Rrh) Protein (O35214) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPT NAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVA MDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR NNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTK MSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKK FRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rrh |
Synonyms | Rrh; Visual pigment-like receptor peropsin |
UniProt ID | O35214 |
◆ Native Proteins | ||
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
LDL-242H | Native Human Lipoproteins, High Density | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-9H | Human Adult Thymus Membrane Lysate | +Inquiry |
PDZD11-3315HCL | Recombinant Human PDZD11 293 Cell Lysate | +Inquiry |
KCNJ8-5043HCL | Recombinant Human KCNJ8 293 Cell Lysate | +Inquiry |
RPS6KA6-674HCL | Recombinant Human RPS6KA6 cell lysate | +Inquiry |
LTC4S-668HCL | Recombinant Human LTC4S cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Rrh Products
Required fields are marked with *
My Review for All Rrh Products
Required fields are marked with *
0
Inquiry Basket