Recombinant Full Length Mouse Vip36-Like Protein(Lman2L) Protein, His-Tagged
Cat.No. : | RFL25519MF |
Product Overview : | Recombinant Full Length Mouse VIP36-like protein(Lman2l) Protein (P59481) (44-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (44-347) |
Form : | Lyophilized powder |
AA Sequence : | GQAVEYLKREHSLSKPYQGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLKDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQHERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNIRYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEMPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTGVRTPEEEKLHRDVFLPSVDNLKLPEMTVPPTPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQDQSRKRFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lman2l |
Synonyms | Lman2l; Vipl; VIP36-like protein; Lectin mannose-binding 2-like; LMAN2-like protein |
UniProt ID | P59481 |
◆ Recombinant Proteins | ||
LMAN2L-8613H | Recombinant Human LMAN2L protein, His-tagged | +Inquiry |
LMAN2L-1273H | Recombinant Human LMAN2L protein(Met1-Ala304), hFc-tagged | +Inquiry |
RFL25519MF | Recombinant Full Length Mouse Vip36-Like Protein(Lman2L) Protein, His-Tagged | +Inquiry |
LMAN2L-8612H | Recombinant Human LMAN2L, Fc tagged | +Inquiry |
LMAN2L-300H | Recombinant Human LMAN2L Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMAN2L-1393HCL | Recombinant Human LMAN2L cell lysate | +Inquiry |
LMAN2L-1161HCL | Recombinant Human LMAN2L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lman2l Products
Required fields are marked with *
My Review for All Lman2l Products
Required fields are marked with *
0
Inquiry Basket