Recombinant Full Length Mouse Vang-Like Protein 1(Vangl1) Protein, His-Tagged
Cat.No. : | RFL8849MF |
Product Overview : | Recombinant Full Length Mouse Vang-like protein 1(Vangl1) Protein (Q80Z96) (1-526aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-526) |
Form : | Lyophilized powder |
AA Sequence : | MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQAPAGEPLLAND SARTGAEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASF LGLLVFLTPIAFILLPQILWREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRAD VPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDQNYKDIVQYAVSLVDALLFIHYLAI VLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTAS KFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRR ARLVVAVEEAFIHIQRLQAEEQQKSPGEVMDPREAAQAIFPSMARALQKYLRTTRQQHYH SMESILQHLAFCITNSMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLISEEAVTNGLRDG IVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Vangl1 |
Synonyms | Vangl1; Lpp2; Vang-like protein 1; Loop-tail protein 2; Van Gogh-like protein 1 |
UniProt ID | Q80Z96 |
◆ Recombinant Proteins | ||
RFL8849MF | Recombinant Full Length Mouse Vang-Like Protein 1(Vangl1) Protein, His-Tagged | +Inquiry |
VANGL1-11765Z | Recombinant Zebrafish VANGL1 | +Inquiry |
RFL17084HF | Recombinant Full Length Human Vang-Like Protein 1(Vangl1) Protein, His-Tagged | +Inquiry |
Vangl1-1483M | Recombinant Mouse Vangl1 protein, His & T7-tagged | +Inquiry |
Vangl1-6895M | Recombinant Mouse Vangl1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VANGL1-433HCL | Recombinant Human VANGL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vangl1 Products
Required fields are marked with *
My Review for All Vangl1 Products
Required fields are marked with *
0
Inquiry Basket