Recombinant Full Length Mouse Transmembrane Protein 74(Tmem74) Protein, His-Tagged
Cat.No. : | RFL2950MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 74(Tmem74) Protein (Q8BQU7) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MELHSLSKRNSPVDPCNALEWSSGETSGDHIEEATIRDAFCYQKNLVSTPRADVVEVCRL STSPASPTSLLQDSAIQTSFSLSGPPDSGNNQVMADRKVCNCCSQELETSFTYVDENVNL EQRSQRSPSAKGSNHPVDLGWGNPNEWSHETAMSLMSEDDDDTSSEATSSGKSVDYGFIS AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESAMLGAHLDRCVIAGLCLLT LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNEDTLELSLVEEDA LAVQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem74 |
Synonyms | Tmem74; Transmembrane protein 74 |
UniProt ID | Q8BQU7 |
◆ Recombinant Proteins | ||
C1QL3-5830HFL | Recombinant Full Length Human C1QL3 protein, Flag-tagged | +Inquiry |
RFL12741EF | Recombinant Full Length Enterobacteria Phage Prd1 Protein P34(Xxxiv) Protein, His-Tagged | +Inquiry |
KRTAP5-8-4806H | Recombinant Human KRTAP5-8 Protein, GST-tagged | +Inquiry |
ATP11B-262H | Recombinant Human ATP11B Protein, His-tagged | +Inquiry |
CRYBB3-1273R | Recombinant Rat CRYBB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-322H | Native Human Collagen IV | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
Thromboplastin-078R | Native Rabbit Thromboplastin Protein | +Inquiry |
IgG1 Fc-08H | Native Human Immunoglobulin G1 (IgG1) FC Fragment | +Inquiry |
CA 72-4-379H | Active Native Human Cancer Antigen 72-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERINC3-1943HCL | Recombinant Human SERINC3 293 Cell Lysate | +Inquiry |
RBM39-2470HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
Kidney-491C | Chicken Kidney Lysate, Total Protein | +Inquiry |
CPBTT-30930RH | Rabbit Anti-Human AKT Polyclonal Antibody | +Inquiry |
SLITRK4-1719HCL | Recombinant Human SLITRK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem74 Products
Required fields are marked with *
My Review for All Tmem74 Products
Required fields are marked with *
0
Inquiry Basket