Recombinant Full Length Mouse Transmembrane Protein 50A(Tmem50A) Protein, His-Tagged
Cat.No. : | RFL35439MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 50A(Tmem50a) Protein (Q9CXL1) (1-157aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-157) |
Form : | Lyophilized powder |
AA Sequence : | MSGFLEGSRCSECMDWGEKRNTIASIAAGVLFFTGWWIIIDAAVMYPRMDQFNHSYHTCG VIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFIGFMLAFGSLIASMWILFGGYV AKEKDVVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem50a |
Synonyms | Tmem50a; Smp1; Transmembrane protein 50A; Small membrane protein 1 |
UniProt ID | Q9CXL1 |
◆ Recombinant Proteins | ||
RFL16326HF | Recombinant Full Length Human Transmembrane Protein 50A(Tmem50A) Protein, His-Tagged | +Inquiry |
TMEM50A-12687Z | Recombinant Zebrafish TMEM50A | +Inquiry |
RFL35439MF | Recombinant Full Length Mouse Transmembrane Protein 50A(Tmem50A) Protein, His-Tagged | +Inquiry |
TMEM50A-4643R | Recombinant Rhesus Macaque TMEM50A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM50A-4829R | Recombinant Rhesus monkey TMEM50A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM50A-946HCL | Recombinant Human TMEM50A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem50a Products
Required fields are marked with *
My Review for All Tmem50a Products
Required fields are marked with *
0
Inquiry Basket