Recombinant Full Length Mouse Transmembrane Protein 220(Tmem220) Protein, His-Tagged
Cat.No. : | RFL3510MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 220(Tmem220) Protein (Q8BP07) (1-167aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-167) |
Form : | Lyophilized powder |
AA Sequence : | MAPAVATWAPGLWRACNALMAAFFALAAVVQVNDPDAELWVVVYMIPAVLTLLVGFNPLV TGNFIWKSVSAIHMLFCALWAGGLAYHFLLHAKQNLLNEEEGRELSGLVIVTAWMALCHS SSKNPGGGRMHLAIAVVITLLPLLSWVYVHMNKEMRSSWPTHCKTVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem220 |
Synonyms | Tmem220; Transmembrane protein 220 |
UniProt ID | Q8BP07 |
◆ Recombinant Proteins | ||
Aoc1-669M | Recombinant Mouse Aoc1 protein, His-tagged | +Inquiry |
RBM39-2216H | Recombinant Human RBM39, GST-tagged | +Inquiry |
SUCLG1-8852M | Recombinant Mouse SUCLG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGN2-3368H | Recombinant Human HMGN2 Protein (Pro2-Gln81), His tagged | +Inquiry |
RDH11-3654R | Recombinant Rhesus Macaque RDH11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CKMB-256H | Active Native Human CKMB protein | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Alb-503R | Native Rat Alb Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OBP2B-3608HCL | Recombinant Human OBP2B 293 Cell Lysate | +Inquiry |
CLN3-367HCL | Recombinant Human CLN3 cell lysate | +Inquiry |
CD1d1-2446MCL | Recombinant Mouse CD1d1 cell lysate | +Inquiry |
PTPN3-2683HCL | Recombinant Human PTPN3 293 Cell Lysate | +Inquiry |
LGALS8-4762HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem220 Products
Required fields are marked with *
My Review for All Tmem220 Products
Required fields are marked with *
0
Inquiry Basket