Recombinant Full Length Mouse Transmembrane Protein 203(Tmem203) Protein, His-Tagged
Cat.No. : | RFL28105MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 203(Tmem203) Protein (Q8R235) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLTPGLSWWNVFVPFFAADGLS TYFTTIVSVRLFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLVEQTRELWFGLITSP VFILLQLLMIRACRVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem203 |
Synonyms | Tmem203; Transmembrane protein 203 |
UniProt ID | Q8R235 |
◆ Recombinant Proteins | ||
SOX9-5854C | Recombinant Chicken SOX9 | +Inquiry |
RFL7589SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Fyv5(Fyv5) Protein, His-Tagged | +Inquiry |
ITGB4-6964H | Recombinant Human ITGB4 protein, His & T7-tagged | +Inquiry |
TPGS2-6238R | Recombinant Rat TPGS2 Protein | +Inquiry |
LY6I-3511R | Recombinant Rat LY6I Protein | +Inquiry |
◆ Native Proteins | ||
IBVF0704-224I | Native Influenza (B/Florida 07/04 ) IBVF0704 protein | +Inquiry |
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
LDLR-85H | Native Human Lipoprotein | +Inquiry |
Fxa-283B | Active Native Bovine Factor Xa - DEGR | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Diaphragm-512D | Dog Diaphragm Lysate, Total Protein | +Inquiry |
RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
ZCCHC8-199HCL | Recombinant Human ZCCHC8 293 Cell Lysate | +Inquiry |
DHRS13-6938HCL | Recombinant Human DHRS13 293 Cell Lysate | +Inquiry |
RPL29-1539HCL | Recombinant Human RPL29 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem203 Products
Required fields are marked with *
My Review for All Tmem203 Products
Required fields are marked with *
0
Inquiry Basket