Recombinant Full Length Mouse Transmembrane Protein 198(Tmem198) Protein, His-Tagged
Cat.No. : | RFL113MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 198(Tmem198) Protein (Q8BG75) (1-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-360) |
Form : | Lyophilized powder |
AA Sequence : | MPGTMETLRFQLLPPEPDDTFWGAPCEQPLERRYQALPALVCIMCCLFGVVYCFFGYRCF KAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFL VGLLLGLLLAAAALLGSAPYYQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTG AALIATAADYFAELLLLGRYVVERLRAAPVPPLCWRSWALLALWPLLSLMGVLVQWRVTT ERDSHTEVVISRQRRRVQLMRIRQQEERKEKRRKKRPPRAPPRGPRAPPRPGPPDPAYRR RPVPIKRFNGDVLSPSYIQSFRDRQTGSSLSSFMASPTDTDYEYGSRGPLTACSGPPVRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem198 |
Synonyms | Tmem198; Transmembrane protein 198 |
UniProt ID | Q8BG75 |
◆ Recombinant Proteins | ||
LILRA4-166H | Recombinant Human LILRA4 Protein, Glu24-Asn446, C-His-Avi tagged, Biotinylated | +Inquiry |
HA-1096V | Recombinant Influenza A H16N3 (A/black-headed gull/Sweden/5/99) HA protein(Met1-Arg343), His-tagged | +Inquiry |
RDH11-14046M | Recombinant Mouse RDH11 Protein | +Inquiry |
E2f1-2707M | Recombinant Mouse E2f1 Protein, Myc/DDK-tagged | +Inquiry |
FCGRT & B2M-103CB | Recombinant Cynomolgus FCGRT & B2M protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Proteasome 19S-39H | Native Human Proteasome 19S Protein, Tag Free | +Inquiry |
SRC-29697TH | Native Human SRC | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM8A-2465HCL | Recombinant Human RBM8A 293 Cell Lysate | +Inquiry |
CCL22-7728HCL | Recombinant Human CCL22 293 Cell Lysate | +Inquiry |
DCAF15-7057HCL | Recombinant Human DCAF15 293 Cell Lysate | +Inquiry |
ZNF697-2078HCL | Recombinant Human ZNF697 cell lysate | +Inquiry |
KAT5-5089HCL | Recombinant Human KAT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem198 Products
Required fields are marked with *
My Review for All Tmem198 Products
Required fields are marked with *
0
Inquiry Basket