Recombinant Full Length Mouse Transmembrane Protein 194B(Tmem194B) Protein, His-Tagged
Cat.No. : | RFL6631MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 194B(Tmem194b) Protein (Q8CB65) (1-421aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-421) |
Form : | Lyophilized powder |
AA Sequence : | MLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSLKETDLIKTSVSDCYCYNQHSQI QWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESILSFIKCVTHNFWAPEEAEEITIVF SPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLVFVTGIFLFLYAKTLSQSPVFYYSS GTVLGILMTLVFVLLMAKKHIPKYSTFGALMIGCWFASVYVLCQLMEDLKWLWYGNRMYI LGYVVVVGLCSFAACYSHGPLADEGSRDLLMWTLRLFSLALVYTGVAAPQFAYAVLIVLL FSWSLHYLLRAFSYLRWKMRPWFTAEPQVARYLTDDEYREQAEAATARALEELRQACCRP DFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTDSLPA S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nemp2 |
Synonyms | Nemp2; Tmem194b; Nuclear envelope integral membrane protein 2 |
UniProt ID | Q8CB65 |
◆ Recombinant Proteins | ||
DUSP26-4108HF | Recombinant Full Length Human DUSP26 Protein, GST-tagged | +Inquiry |
GTPBP10-1006HFL | Recombinant Full Length Human GTPBP10, Flag-tagged | +Inquiry |
RFL9469HF | Recombinant Full Length Esx-2 Secretion System Protein Eccb2(Eccb2) Protein, His-Tagged | +Inquiry |
GPR108-2300R | Recombinant Rat GPR108 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCL-4672H | Recombinant Human NCL Protein (Asn478-Asn565), N-His tagged | +Inquiry |
◆ Native Proteins | ||
LDH-121B | Active Native Bovine Lactate Dehydrogenase | +Inquiry |
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCTP-3368HCL | Recombinant Human PCTP 293 Cell Lysate | +Inquiry |
CREG1-1069MCL | Recombinant Mouse CREG1 cell lysate | +Inquiry |
FBXO7-608HCL | Recombinant Human FBXO7 cell lysate | +Inquiry |
TMSB4Y-903HCL | Recombinant Human TMSB4Y 293 Cell Lysate | +Inquiry |
Pancreas-670H | Hamster Pancreas Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nemp2 Products
Required fields are marked with *
My Review for All Nemp2 Products
Required fields are marked with *
0
Inquiry Basket