Recombinant Full Length Esx-2 Secretion System Protein Eccb2(Eccb2) Protein, His-Tagged
Cat.No. : | RFL9469HF |
Product Overview : | Recombinant Full Length ESX-2 secretion system protein eccB2(eccB2) Protein (O05449) (1-495aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-495) |
Form : | Lyophilized powder |
AA Sequence : | MPLSLSNRDQNSGHLFYNRRLRAATTRFSVRMKHDDRKQTAALALSMVLVAIAAGWMMLL NVLKPTGIVGDSAIIGDRDSGALYARIDGRLYPALNLTSARLATGTAGQPTWVKPAEIAK YPTGPLVGIPGAPAAMPVNRGAVSAWAVCDTAGRPRSADKPVVTSIAGPITGGGRATHLR DDAGLLVTFDGSTYVIWGGKRSQIDPTNRAVTLSLGLDPGVTSPIQISRALFDGLPATEP LRVPAVPEAGTPSTWVPGARVGSVLQAQTAGGGSQFYVLLPDGVQKISSFVADLLRSANS YGAAAPRVVTPDVLVHTPQVTSLPVEYYPAGRLNFVDTAADPTTCVSWEKASTDPQARVA VYNGRGLPVPPSMDSRIVRLVRDDRAPASVVATQVLVLPGAANFVTSTSGVITAESRESL FWVSGNGVRFGIANDEATLRALGLDPGAAVQAPWPLLRTFAAGPALSRDAALLARDTVPT LGQVAIVTTTAKAGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ESX-2 secretion system protein eccB2(eccB2) |
UniProt ID | O05449 |
◆ Recombinant Proteins | ||
GIMAP2-3419H | Recombinant Human GIMAP2 protein, His-tagged | +Inquiry |
ERBB3-2614H | Recombinant Human ERBB3 Protein (Ser20-Cys331), C-Fc tagged | +Inquiry |
CDK19-3778HF | Recombinant Full Length Human CDK19 Protein, GST-tagged | +Inquiry |
RIC3-3892R | Recombinant Rhesus monkey RIC3 Protein, His-tagged | +Inquiry |
KLK1-3228H | Recombinant Human KLK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-49B | Native Bovine Collagen Type XI/XI | +Inquiry |
KNG1-1844H | Native Human Kininogen 1 | +Inquiry |
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
Lectin-1805L | Active Native Lycopersicon Esculentum Lectin Protein, Fluorescein labeled | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-271H | Human Kidney Membrane Lysate | +Inquiry |
CCDC7-7753HCL | Recombinant Human CCDC7 293 Cell Lysate | +Inquiry |
ALDH1L1-17HCL | Recombinant Human ALDH1L1 lysate | +Inquiry |
DLX4-6905HCL | Recombinant Human DLX4 293 Cell Lysate | +Inquiry |
MICB-2885HCL | Recombinant Human MICB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESX-2 secretion system protein eccB2(eccB2) Products
Required fields are marked with *
My Review for All ESX-2 secretion system protein eccB2(eccB2) Products
Required fields are marked with *
0
Inquiry Basket