Recombinant Full Length Mouse Transmembrane Protein 19(Tmem19) Protein, His-Tagged
Cat.No. : | RFL7287MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 19(Tmem19) Protein (Q91W52) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MTDSDDTTCKRYIKMITNIVILSLIICISLAFWIMSMTASTYYGNFRPVSPWRWLFSVVV PVVIACNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLMTFFLSSSKLTKWRGNIKKQ LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEMPIDFSKQHTASWMCLSLLAAL ASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLASSLLGGTFVGLAYFLT QLVFVNDLDISAPQWPIIAFGGVAGLFGSLVDSFLGATMQFSGLDERTGLVVSSPTQETK HIAGKPILDNNAVNLFSSVLVALLLPTAASGFWPRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem19 |
Synonyms | Tmem19; Transmembrane protein 19 |
UniProt ID | Q91W52 |
◆ Recombinant Proteins | ||
GCC2-2143R | Recombinant Rat GCC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEDVgp6-P | Recombinant PEDV PEDVgp6 Protein, His-tagged | +Inquiry |
PJA2-4139R | Recombinant Rat PJA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CREB3L3-1966M | Recombinant Mouse CREB3L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
IgG2B-2131M | Recombinant Mouse IgG2B protein | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
DIS-2020 | Active Cyclodextrin Glucanotransferase (Powder) | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDB2-4791HCL | Recombinant Human LDB2 293 Cell Lysate | +Inquiry |
POLR3GL-3023HCL | Recombinant Human POLR3GL 293 Cell Lysate | +Inquiry |
MAN2B1-4524HCL | Recombinant Human MAN2B1 293 Cell Lysate | +Inquiry |
CDR2-7607HCL | Recombinant Human CDR2 293 Cell Lysate | +Inquiry |
GLTP-5893HCL | Recombinant Human GLTP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem19 Products
Required fields are marked with *
My Review for All Tmem19 Products
Required fields are marked with *
0
Inquiry Basket