Recombinant Full Length Mouse Transmembrane Protein 151B(Tmem151B) Protein, His-Tagged
Cat.No. : | RFL34647MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 151B(Tmem151b) Protein (Q68FE7) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MSPPGSAAGESAGGGGGGGGSGVPEEPMASADEGPAREEQRPIQPSFTKSLCRESHWKCL LLSLLMYGCLGAVAWCHVTTVTRLTFSSAYQGNSLMYHDSPCSNGYVYIPLAFLLMLYAV YLVECWHCQARHELQHRVDVSSVQERVGRMQQATPCIWWKAISYHYVRRTRQVTRYRNGD AYTTTQVYHERVNTHVAEAEFDYARCGVRDVSKTLVGLEGAPATRLRFTKCFSFASVEAE NAYLCQRARFFAENEGLDDYMEAREGMHLKNVDFREFMVAFPDPARPPWYACSSAFWAAA LLTLSWPLRVLAEYRTAYAHYHVEKLFGLEGPGSASSVGGGLSPSDELLPPLTHRLPRVN TVDSTELEWHIRSNQQLVPSYSEVLLMDLVELGSRCGGPGGSYVPRCRYGGVGGPGAAGV TPHWRSCEHCQRAVSSSSIFSRSALSICASPRAAQGPGASAGCGGSRFSLSRLYGSRRSC LWRSRSGSVNEASCPTEQTRLSSQASMRDNEEDEDEEEAGPPPPYQDALCFPVLIVHRQE GCLGHSHRSLHRHGSCVETSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem151b |
Synonyms | Tmem151b; Gm323; Transmembrane protein 151B |
UniProt ID | Q68FE7 |
◆ Recombinant Proteins | ||
GUDB-0690B | Recombinant Bacillus subtilis GUDB protein, His-tagged | +Inquiry |
RFL5138MF | Recombinant Full Length Mouse Transmembrane Protein 93(Tmem93) Protein, His-Tagged | +Inquiry |
NECAB1-5998M | Recombinant Mouse NECAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ear3-1754M | Recombinant Mouse Ear3 protein, His & T7-tagged | +Inquiry |
MLH1-233H | Recombinant Human MLH1, StrepII-tagged | +Inquiry |
◆ Native Proteins | ||
SERPING1-73H | Native Human C1 Esterase inhibitor | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
Chitosan-004C | Native Crawfish Chitosan Film | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R8-2932HCL | Recombinant Human PPP1R8 293 Cell Lysate | +Inquiry |
Fetal Thyroid-175H | Human Fetal Thyroid Lysate | +Inquiry |
UPP1-494HCL | Recombinant Human UPP1 293 Cell Lysate | +Inquiry |
NIH/3T3-065MCL | Mouse PDGF Stimulated NIH/3T3 Whole Cell Lysate | +Inquiry |
HA-699HCL | Recombinant H7N7 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem151b Products
Required fields are marked with *
My Review for All Tmem151b Products
Required fields are marked with *
0
Inquiry Basket