Recombinant Full Length Mouse Transmembrane Protein 151A(Tmem151A) Protein, His-Tagged
Cat.No. : | RFL14250MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 151A(Tmem151a) Protein (Q6GQT5) (1-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-468) |
Form : | Lyophilized powder |
AA Sequence : | MPEGEGGDCGEVPALVPDGEPLREEQRPLKQSLGGSLCRESHWKCLLLTLLIHACGAVVA WCRLATVPRLVLGPEAALARGAGGPPPTYPASPCSDGYLYIPLAFVSLLYLLYLAECWHC HVRSCQAPRTDANTVLALIHRLQQAPPCVWWKATSYHYVRRTRQITRYRNGDAYTTTQVY HERADSRTARGEFDYSAHGVRDVSKELVGLADHAATRLRFTKCFSFGSAEAEASYLTQRA RFFSANEGLDDYLEAREGMHLKDVDFRESLMVFADPRSPPWYARAWVFWLVSAATLSWPL RVVAAYGTAHVHYQVEKLFGASSPPPGAVPSGPPLSRVATVDFTELEWHICSNRQLVPSY SEAVVMGASSGAYLRGCQRCRRSVSSNSLPPARPSGPRLPFSRSRLSLGAGGRTTPGVFR SLSGGPLGRRGEDTEPLESPPCYEDALYFPVLIVHGDSGCRGDGQGAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem151a |
Synonyms | Tmem151a; Gm961; Tmem151; Transmembrane protein 151A |
UniProt ID | Q6GQT5 |
◆ Recombinant Proteins | ||
RFL27269HF | Recombinant Full Length Human Transmembrane Protein 151A(Tmem151A) Protein, His-Tagged | +Inquiry |
TMEM151A-16932M | Recombinant Mouse TMEM151A Protein | +Inquiry |
Tmem151a-6478M | Recombinant Mouse Tmem151a Protein, Myc/DDK-tagged | +Inquiry |
TMEM151A-9309M | Recombinant Mouse TMEM151A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14250MF | Recombinant Full Length Mouse Transmembrane Protein 151A(Tmem151A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM151A-996HCL | Recombinant Human TMEM151A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem151a Products
Required fields are marked with *
My Review for All Tmem151a Products
Required fields are marked with *
0
Inquiry Basket