Recombinant Full Length Mouse Transmembrane Anterior Posterior Transformation Protein 1(Tapt1) Protein, His-Tagged
Cat.No. : | RFL3655MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane anterior posterior transformation protein 1(Tapt1) Protein (Q4VBD2) (2-564aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-564) |
Form : | Lyophilized powder |
AA Sequence : | AGVCDAAAPGEGGGGGADGPERTGRGEAEQPGGGGHGPAPQHTETLGFYESDRRREKRRG RAELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCMRIPRELEKLMFFGIFLCLDAFL YVFTLLPLRVFLALFRLLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVDYSMM YHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIPHFFM AVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSN SDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFITKFN DITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSSIKVQ GILSYACVILFYFGLISLKILNSIVLLGKSCQYVKEAKMEEKLFNPPPASTPGKPSSKSQ SKGKPSQGLSTEENLSASVTSQPGHQKENVIPLLVTSNSDQFLTTPDGDEKDITQENSEL KHRSSKKDLLEIDRFTICGNRID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tapt1 |
Synonyms | Tapt1; Transmembrane anterior posterior transformation protein 1 |
UniProt ID | Q4VBD2 |
◆ Recombinant Proteins | ||
CDH5-081H | Recombinant Human cadherin 5 Protein, Tag Free | +Inquiry |
BLAR1-3501S | Recombinant Staphylococcus aureus (strain: CDC61, other: HA-MRSA) BLAR1 protein, His-tagged | +Inquiry |
RCL1-1152Z | Recombinant Zebrafish RCL1 | +Inquiry |
CD200R1-27295TH | Recombinant Human CD200R1, GST-tagged | +Inquiry |
FOXI1-4454H | Recombinant Human FOXI1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
ALB-124P | Native Porcine serum albumin | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDH2-8472HCL | Recombinant Human BDH2 293 Cell Lysate | +Inquiry |
TMEM45A-949HCL | Recombinant Human TMEM45A 293 Cell Lysate | +Inquiry |
CD44-1090HCL | Recombinant Human CD44 cell lysate | +Inquiry |
COPRS-8229HCL | Recombinant Human C17orf79 293 Cell Lysate | +Inquiry |
ZNF44-2027HCL | Recombinant Human ZNF44 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tapt1 Products
Required fields are marked with *
My Review for All Tapt1 Products
Required fields are marked with *
0
Inquiry Basket