Recombinant Full Length Mouse Transmembrane And Coiled-Coil Domains Protein 3(Tmcc3) Protein, His-Tagged
Cat.No. : | RFL18562MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane and coiled-coil domains protein 3(Tmcc3) Protein (Q8R310) (1-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-477) |
Form : | Lyophilized powder |
AA Sequence : | MPGSDTALTVDRTYSDPGRHHRCKSRVDRHDMNTLSLPLNIRRGGSDTNLNFDVPDGILD FHKVKLNADSLRQKILKVTEQIKIEQTSRDGNVAEYLKLVSSADKQQAGRIKQVFEKKNQ KSAHSIAQLQKKLEQYHRKLREIEQNGVTRSSKDISKDSLKEIHHSLKDAHVKSRTAPHC LESSKSSMPGVSLTPPVFVFNKSREFANLIRNKFGSADNIAHLKNSLEEFRPEASPRAYG GSATIVNKPKYGSDDECSSGTSGSADSNGNQSFGAGGTSTLDSQGKIAKIMEELREIKVT QTQLAEDIEALKVQFKREYGFISQTLQEERYRYERLEDQLHDLTELHQHETANLKQELAS AEEKVAYQAYERSRDIQEALESCQTRISKLELHQQEQQTLQTDAVNAKVLLGKCINVVLA FMTVILVCVSTLAKFVSPMMKSRSHILGTFFAVTLLAIFCKNWDHILCAIERIIIPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmcc3 |
Synonyms | Tmcc3; Transmembrane and coiled-coil domain protein 3 |
UniProt ID | Q8R310 |
◆ Recombinant Proteins | ||
SPATA31-5350R | Recombinant Rat SPATA31 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLN-3658R | Recombinant Rat NLN Protein, His (Fc)-Avi-tagged | +Inquiry |
HES1-2829R | Recombinant Rat HES1 Protein | +Inquiry |
Spike-4612V | Active Recombinant COVID-19 Spike S2 protein (BA.1/Omicron), His/Avi-tagged, Biotinylated | +Inquiry |
RFL29927RF | Recombinant Full Length Rhizobium Etli Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
TF-62H | Native Human Apo Transferrin Protein, Tag Free | +Inquiry |
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
TF-31156TH | Native Human TF | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-67H | Human Testis Tumor Tissue Lysate | +Inquiry |
ALDH1L1-17HCL | Recombinant Human ALDH1L1 lysate | +Inquiry |
ATP12A-8614HCL | Recombinant Human ATP12A 293 Cell Lysate | +Inquiry |
ARL8B-8704HCL | Recombinant Human ARL8B 293 Cell Lysate | +Inquiry |
PRPF31-2826HCL | Recombinant Human PRPF31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmcc3 Products
Required fields are marked with *
My Review for All Tmcc3 Products
Required fields are marked with *
0
Inquiry Basket