Recombinant Full Length Mouse Transmembrane And Coiled-Coil Domains Protein 2(Tmcc2) Protein, His-Tagged
Cat.No. : | RFL6862MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane and coiled-coil domains protein 2(Tmcc2) Protein (Q80W04) (1-706aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-706) |
Form : | Lyophilized powder |
AA Sequence : | MKRCKSDELQQQQGEEDGAGMEDAACLLPGADLRHGEASSANSAGGPTSDAGAAVAPNPG PRSKPPDLKKIQQLSEGSMFGHGLKHLFHSRRRSREREHQASQEAQQQQQQQGLSDQDSP DEKERSPEMHRVSYAVSLHDLPARPTAFNRVLQQIRSRPSIKRGASLHSSGGSGGRRAKS SSLEPQRGSPHLLRKAPQDSSLAAILHQHQGRPRSSSTTDTALLLADGSSAYLLAEEAES IGDKGDKGDLVALSLPSGPGHGDSDGPISLDVPDGAPDPQRTKAAIEHLHQKILKITEQI KIEQEARDDNVAEYLKLANNADKQQVSRIKQVFEKKNQKSAQTIAQLHKKLEHYRRRLKE IEQNGPSRQPKDVLRDMQQGLKDVGANMRAGISGFGGGVVEGVKGSLSGLSQATHTAVVS KPREFASLIRNKFGSADNIAHLKDPMEDGPPEEAARALSGSATLVSSPKYGSDDECSSAS ASSAGAGSNSGAGPGGALGSPRSNTLYGAPGNLDTLLEELREIKEGQSHLEDSMEDLKTQ LQRDYTYMTQCLQEERYRYERLEEQLNDLTELHQNEMTNLKQELASMEEKVAYQSYERAR DIQEAVESCLTRVTKLELQQQQQQVVQLEGVENANARALLGKFINVILALMAVLLVFVST IANFITPLMKTRLRITSTALLLLVLFLLWKHWASLTYLLEHVLLPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmcc2 |
Synonyms | Tmcc2; Kiaa0481; Transmembrane and coiled-coil domains protein 2 |
UniProt ID | Q80W04 |
◆ Recombinant Proteins | ||
RFL30885RF | Recombinant Full Length Rat G Protein-Activated Inward Rectifier Potassium Channel 1(Kcnj3) Protein, His-Tagged | +Inquiry |
ZFPM2A-3638Z | Recombinant Zebrafish ZFPM2A | +Inquiry |
SIRPA-5659H | Recombinant Human SIRPA Protein (Lys32-Asn372), C-His tagged | +Inquiry |
METTL23-3315R | Recombinant Rat METTL23 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF1AY-28548TH | Recombinant Human EIF1AY, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
Laminin-01H | Native Human Laminin Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS6-1577HCL | Recombinant Human SOCS6 293 Cell Lysate | +Inquiry |
ERG-6560HCL | Recombinant Human ERG 293 Cell Lysate | +Inquiry |
FXYD3-6101HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
ADRM1-8997HCL | Recombinant Human ADRM1 293 Cell Lysate | +Inquiry |
LYPD6B-397HCL | Recombinant Human LYPD6B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmcc2 Products
Required fields are marked with *
My Review for All Tmcc2 Products
Required fields are marked with *
0
Inquiry Basket