Recombinant Full Length Mouse Transmembrane And Coiled-Coil Domains Protein 1(Tmcc1) Protein, His-Tagged
Cat.No. : | RFL23252MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane and coiled-coil domains protein 1(Tmcc1) Protein (Q69ZZ6) (1-649aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-649) |
Form : | Lyophilized powder |
AA Sequence : | MEPSGSEQLYEDPDPGGKSQDAEARRQTESEQKLSKMTHNALENINVIGQGLKHLFQHQR RRSSVSPHDVQQIQTDPEPEVDLDSQNACAEIDGVSTHPTALNRVLQQIRVPPKMKRGTS LHSRRGKSEAPKGSPQINRKSGQEVAAVIQSGRPRSSSTTDAPTSSSVMEIACAAGVCVP GEEATAERIERLEVSSLAQTSSAVASSTDGSIHTESVDGIPDPQRTKAAIAHLQQKILKL TEQIKIAQTARDDNVAEYLKLANSADKQQAARIKQVFEKKNQKSAQTILQLQKKLEHYHR KLREVEQNGIPRQPKDVFRDMHQGLKDVGAKVTGFSEGVVDSVKGGFSSFSQATHSAAGA VVSKPREIASLIRNKFGSADNIPNLKDSLEEGQVDDGGKALGVISNFQSSPKYGSEEDCS SATSGSVGANSTTGGIAVGASSSKTNTLDMQSSGFDALLHEVQEIRETQARLEDSFETLK EHYQRDYSLIMQTLQEERYRCERLEEQLNDLTELHQNEILNLKQELASMEEKIAYQSYER ARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGKLINILLAVMAVLLVFV STVANCVVPLMKTRNRTFSTLFLVAFIAFLWKHWDALFSYVDRLFSPPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmcc1 |
Synonyms | Tmcc1; Kiaa0779; Transmembrane and coiled-coil domains protein 1 |
UniProt ID | Q69ZZ6 |
◆ Recombinant Proteins | ||
S-1234S | Recombinant SARS S (N) Protein | +Inquiry |
OXCT1-3883R | Recombinant Rat OXCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL23-215H | Recombinant Human CCL23, His tagged | +Inquiry |
BECN1-190H | Recombinant Human BECN1 Protein, GST-tagged | +Inquiry |
CCL22-67H | Recombinant Human CCL22 protein | +Inquiry |
◆ Native Proteins | ||
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCAF12L1-7058HCL | Recombinant Human DCAF12L1 293 Cell Lysate | +Inquiry |
SERHL-1946HCL | Recombinant Human SERHL 293 Cell Lysate | +Inquiry |
PRDM7-2884HCL | Recombinant Human PRDM7 293 Cell Lysate | +Inquiry |
F2RL3-6483HCL | Recombinant Human F2RL3 293 Cell Lysate | +Inquiry |
UFL1-4969HCL | Recombinant Human KIAA0776 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmcc1 Products
Required fields are marked with *
My Review for All Tmcc1 Products
Required fields are marked with *
0
Inquiry Basket