Recombinant Full Length Mouse Transmembrane And Coiled-Coil Domain-Containing Protein 6(Tmco6) Protein, His-Tagged
Cat.No. : | RFL30602MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane and coiled-coil domain-containing protein 6(Tmco6) Protein (Q8BQX5) (1-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-494) |
Form : | Lyophilized powder |
AA Sequence : | MWNRRQGRLRTLAFGVEELRRRRREREAALRKARREQQLVSKRLLREDAPEEVGGQSAAV LLGEAEVQQFLRLAQRGTDEKEREKALVSLRRGLQHPDTQQTFIRLEGSMRTLVGILTSN RALLQLEAARCLHELSHSEQSAVAEACLPATSYLLTYLSGHSSDFIELCLYTLGNLIVES EAVRKQLLPQGIVPAFAACIQSPHVAVLEALGYALSQLLQAKEAPEKIIPSILDSSLPQQ MLWLMQPGPKLNLGVAMEFAWCLHYIICSQVNNAVLLTHGALPTLALLLLDLAGTVQRMD DVGLELLACPVLRCLSNLLTEVPAEVMGQQMELRDERLVAALFIFLQFFLQKQPALLPEG LWLLNNLTANSPTFCTSLLSLDLIEPLLQLLPLSNAVCMLVLTVLCNVVEKGPAYCQRLW PGPLLSCVLNTLALSDTEVVGQSLELLQLLFLHQPEAARAFLQQSGLQALEKLQEETQLQ ERIHALQQIAATHG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmco6 |
Synonyms | Tmco6; Transmembrane and coiled-coil domain-containing protein 6 |
UniProt ID | Q8BQX5 |
◆ Recombinant Proteins | ||
CYP3A7-1161R | Recombinant Rhesus monkey CYP3A7 Protein, His-tagged | +Inquiry |
RPS3-6890H | Recombinant Human Ribosomal Protein S3, His-tagged | +Inquiry |
ERAL1-5812C | Recombinant Chicken ERAL1 | +Inquiry |
TNF-716B | Active Recombinant Bovine TNF Protein | +Inquiry |
SCYL2-3922R | Recombinant Rhesus Macaque SCYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-27925TH | Native Human PLG | +Inquiry |
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF15-1386RCL | Recombinant Rat TNFSF15 cell lysate | +Inquiry |
GRM8-5731HCL | Recombinant Human GRM8 293 Cell Lysate | +Inquiry |
CPN2-195HCL | Recombinant Human CPN2 lysate | +Inquiry |
FAM89B-589HCL | Recombinant Human FAM89B cell lysate | +Inquiry |
C10orf84-8360HCL | Recombinant Human C10orf84 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmco6 Products
Required fields are marked with *
My Review for All Tmco6 Products
Required fields are marked with *
0
Inquiry Basket